KEGG   Gallus gallus (chicken): 395588
Entry
395588            CDS       T01006                                 

Gene name
MEIS2
Definition
(RefSeq) homeobox protein Meis2
  KO
K16670  homeobox protein Meis2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395588 (MEIS2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, MEIS
    395588 (MEIS2)
SSDB
Motif
Pfam: Meis_PKNOX_N Homeobox_KN Homeodomain
Other DBs
NCBI-GeneID: 395588
NCBI-ProteinID: NP_990134
CGNC: 49388
Ensembl: ENSGALG00000039118
UniProt: Q9PTH1
Position
5
AA seq 401 aa
MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHAGQHYGAHAPHPNV
MPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSFDSFN
EDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLK
GKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGH
ASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLT
HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYS
PEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggcgcaaaggtacgatgagctgccccactacggcgggatggacggcgtaggggtgccg
gcgtccatgtacggggacccgcacgccccccggccgatccccccggtgcaccacctcaac
catgggccgccgctacacgccggacagcactacggcgcccacgccccgcaccccaacgtc
atgccggccagcatgggctccgctgtcaacgacgctctgaagcgggacaaggatgcgatc
tacgggcacccgctgtttcccctcctcgccctggtctttgagaagtgcgagctggcgacc
tgcacgccccgggagcccggcgtggccggcggggacgtctgctccttcgactccttcaac
gaggacatcgccgtcttcgccaagcaggtccgcgctgaaaaaccacttttttcttcaaac
ccagagttggacaatttgatgatccaagcaatacaagtactaaggttccacctcctggag
ttagagaaggttcacgaattgtgcgataacttctgccatcggtacattagttgtttgaaa
gggaaaatgccaatagacctcgtgatcgatgaaagggatggcagctccaagtcagaccac
gaggaactctcaggatcttccacaaatttagccgaccataatccttcatcttggagagac
cacgatgatgcaacctcaacgcactcggcaggcacaccggggccctccagtgggggccat
gcttcccagagtggagacaacagcagcgagcaaggggatggtttagacaacagtgtagcc
tcacctggtactggggatgatgatgacccagacaaggacaaaaagcgacagaagaaaaga
ggcattttccccaaagtagcaacaaatatcatgagagcatggcttttccagcatctcaca
catccatatccttcagaggagcagaagaaacagttagcccaagacacaggacttacaatt
ctacaagtaaacaactggtttattaatgccagaagaagaatagtacagcctatgattgac
cagtcaaatcgagcaggttttcttcttgatccttcagtgagccaaggagcagcatatagt
ccagagggtcagcccatggggagctttgtattggatggtcagcagcacatgggaatccgg
cctgcaggacctatgagtggaatgggcatgaatatgggcatggatgggcaatggcactac
atgtaa

DBGET integrated database retrieval system