KEGG   Gallus gallus (chicken): 395596Help
Entry
395596            CDS       T01006                                 

Gene name
EPAS1
Definition
(RefSeq) endothelial PAS domain-containing protein 1
  KO
K09095  hypoxia-inducible factor 2 alpha
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395596 (EPAS1)
   04131 Membrane trafficking [BR:gga04131]
    395596 (EPAS1)
Transcription factors [BR:gga03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    395596 (EPAS1)
Membrane trafficking [BR:gga04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    395596 (EPAS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_3 PAS_11 HIF-1a_CTAD HIF-1 PAS PAS_9 PAS_4 HLH
Motif
Other DBs
NCBI-GeneID: 395596
NCBI-ProteinID: NP_990138
CGNC: 49393
Ensembl: ENSGALG00000010005
UniProt: Q9W7C6
Position
3
AA seq 867 aa AA seqDB search
MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHNVSSHLDKASIMRLA
ISFLRTHKLLSSVCADNENELEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENVNKYMG
LTQVELTGHSIFDFTHPCDHEEIRENLSLKNGPGFGKKNKEMSTERDFFMRMKCTVTNRG
RTVNLKSATWKVLHCTGQVKVYNTCPPHTLCGYKEPLLTCLIIMCEPIQHPSNIDIPLDS
KTFMSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQ
VVTGQYRMLAKHGGYVWLETQGTVIYNTRNLQPQCIICVNYVLSEIEKNDIVFSMDQTES
LFKPHLLTMSSAFENGISGRDKSDLLFTKLKEEPEELAQLAPTPGDAIISLDFELHPGIQ
KFEEAPAYTSAVLTPNKPWPVEVKSHAAQGETLTIPSFTMPQIAPGSSTPSASSNSSCST
PNSPEDYYTSVDDDLKIEVIEKLFAMDTESKSQCNSQTDFNELDLETLAPYIPMDGEDFQ
LSPICQEERTLSESAQNTQQSLSSMSTIFQPLASASQNQFLPEKYCPQLSNKNINPGHGS
LSSVFFNNMSRSSLPPYHNQASTPLSSMGGRPNTQWPPDPPLEYVPSKWRLMDKYSGTLS
SSPSGPPVRSPNMPIYKKRPLDGLGQRGIDINPARIALSNSLKLKRQLDYEEQALQQLSG
GDPSVINPPQLMWKRMKFLKGENCSLLTEKKSLSTSVLTDEFVCNSRGLSQPMNQLQQQQ
QSTCGSPGENLKAGAFSPQFYSPHYQDYTVQSAHKVSGVTSRLLGSSFEPYLLPELTRYD
CEVNVPVLGSSTLLQGSELLRALDQAT
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgacagctgacaaggagaagaagaggagcagttctgagcggaggaaggagaaatcgaga
gatgctgcaagatgcaggaggagcaaagagacagaagtattctacgaactggctcatgaa
ctgcccctgccccacaatgtcagttcccacctggacaaggcatccataatgcgcctggca
atcagtttcttacgcactcacaagcttctgtcttcagtatgtgctgacaatgagaatgaa
ctagaggcagaccagcagatggacaacttgtacctgaaagctttggagggatttattgcc
gtggtgacacaggatggagacatgatctttttgtcagagaatgtcaacaaatacatgggt
ctcacccaggtggaattaactggacacagcatttttgacttcactcatccatgcgatcat
gaagaaattagagagaatctgagtctgaaaaatggtccaggctttggaaagaaaaacaag
gagatgtcaaccgagcgtgacttcttcatgaggatgaaatgcaccgttaccaacagaggc
agaactgttaacctcaaatctgccacatggaaggttttgcactgcactggacaagttaaa
gtgtacaacacttgccctcctcacactttgtgtgggtataaagagcctcttctcacctgc
cttataataatgtgtgagcctattcagcatccttcaaacattgatatccctctggacagc
aagaccttcatgagtcgccatagcatggacatgaaattcacctactgtgatgacagaata
acagaattgattggataccacccagaagagttgctgggccgttcagcatatgagttctac
catgccttggactcagagaacatgaccaaaagtcatcagaacttgtgtacaaaaggtcaa
gtagtgactggccagtaccgtatgcttgccaagcatggtggatacgtgtggctggaaact
caagggaccgtcatttacaacacgcgcaacctacagcctcagtgtatcatctgtgtcaac
tatgtgctgagtgaaattgagaagaatgatattgtcttctctatggaccaaacggaatcg
ctcttcaagccacacctgttgacgatgagcagtgcctttgagaatgggatctcagggagg
gacaagagtgatttattgtttactaagctaaaagaagaaccggaggaacttgcacaactg
gctccaacacctggagatgccattatttccctggattttgaactccatccagggatacag
aagtttgaggaagcccctgcctatacgagcgctgttttgacaccaaacaaaccgtggcca
gtagaagtgaaaagccatgctgctcaaggtgaaacgctgacaataccatcctttacaatg
ccacagattgcacctggcagcagtactccaagtgcaagcagcaacagtagctgttccacg
ccaaacagcccggaggattactacacttctgtggatgatgatcttaagattgaggtgatt
gaaaaactctttgccatggacacagaatcaaaaagtcagtgcaactctcagactgacttc
aatgaactggaccttgaaaccttagctccttacattcctatggatggagaagatttccag
ctcagccctatctgccaagaagaacgtactctctctgaaagtgcacaaaatacccagcag
agtctaagtagcatgagtaccattttccaacctcttgcttctgcttcacagaatcagttc
ctcccagagaaatattgcccacaactatcaaataaaaacattaaccctggtcatgggtcc
ctatcatcggtgttcttcaacaatatgagtaggtcatcattgccaccataccacaaccaa
gccagcactccgctgtcttcgatggggggtagaccaaacacccagtggccacctgatccg
ccattagaatatgttccttctaaatggagactcatggataaatactcaggaaccctatca
agttccccctcaggacccccagtgcgttctcccaacatgcccatatataaaaaaaggccg
ctggatggtttggggcaacgaggcatagatataaacccagcaagaattgctttgtctaat
agtttgaaactgaagaggcaactggattacgaagagcaagcattgcaacagctgagtggg
ggagatccatctgtcattaacccacctcagttaatgtggaagagaatgaaatttctcaaa
ggggaaaactgttccttgcttacagaaaagaagtctctcagcacaagtgttcttactgat
gagtttgtctgcaactcgagaggtctgagccaaccaatgaatcaactgcagcagcagcag
caatccacctgtggcagtcctggtgaaaatctgaaagcaggagcgttttcccctcagttt
tatagtccccattatcaggactatactgtgcagtcagctcataaagtgtcaggtgtgacg
agtcgtctgctggggtcttcctttgaaccatatttgctgcctgagttgacaagatatgac
tgtgaggtaaacgtccctgttttgggcagttccacgcttctgcagggcagcgaactgctc
agagccctggaccaggcaacctga

DBGET integrated database retrieval system