KEGG   Gallus gallus (chicken): 395598
Entry
395598            CDS       T01006                                 

Gene name
TERF2
Definition
(RefSeq) telomeric repeat-binding factor 2
  KO
K11111  telomeric repeat-binding factor 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gga03032]
    395598 (TERF2)
DNA replication proteins [BR:gga03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomere proteins
    Shelterin complex
     395598 (TERF2)
SSDB
Motif
Pfam: TRF TERF2_RBM Myb_DNA-binding Myb_DNA-bind_6 STG SANT_DAMP1_like
Other DBs
NCBI-GeneID: 395598
NCBI-ProteinID: NP_001258821
CGNC: 415
Ensembl: ENSGALG00000000657
UniProt: Q9PU53 F1NSI5
Position
11
AA seq 718 aa
MAAKRSRAAMEEQEKTSTRSDDREQAVNRWVLQFYFHQAVAAYRAGRNRDFRQLRDVMQA
LLVRPLEREPAVAQMLRVMQFLSRIEEGENLDCTFDKETELTPLESAIGILQLIAKEFSV
PEKKIELIHKVLKEAAVIVCIKNKEFSKALAVLKRHMEKDTGNQKKRTELQTIIREKNRA
HPIIKDFSYVNFQQYMFQFLKTYVDTSEPLLVTMMKSLNSERAEEPKRSSVTPESPSRTE
DQEEAYEPLRRVKHSVGTLRRAETAGGVAGAPSCPEMAKDPTGAPEHVGTVKDAVRAPCP
AESTEDSQGAPRCAETARDVMGAPSPSEMTKDLLGAPKCTETARDVVRAPSPAESTKDPV
GTPGHAETARDVARAPSPAETTKNLPGAPECADTVKNTVRAPSPAERRKDLVRAPKRAET
ARDVVRAPSPAERVKDTAGASEPMKSASYPTASQPRIAAVKSSKVFSVPVEISEQPAAAA
PVHAGVSSRDLERTPFRTVTTYGISVLREAFKMLSNSPDSDALFNKLDETDLPSPQQMSP
SVSHRTKRRKEEKNQGSETLDSPEIPHKSKRLFTISKMIMDQGSQCSKSSESPDSSQERV
VSSAYRPVQELPDQPVSTKRSSQQRWNSSYGEERKDSWSDEDELFTDAALTETSSNNSTV
YGSKKQKWTVQESEWIKDGVRKYGEGRWKTISEKYPFQNRTSVQIKDRYRTMKKLGIA
NT seq 2157 nt   +upstreamnt  +downstreamnt
atggcggcgaagcggtcgcgggccgcaatggaggagcaggagaagacgtcgacgcggagc
gacgaccgcgagcaggcggtcaaccgctgggtgctgcagttctacttccaccaggccgtg
gcggcctaccgtgccgggcggaaccgcgacttccgtcagctccgcgatgtgatgcaggcg
ctgctcgtgcggcccttggagcgggagccggcggtggctcagatgctgcgcgtcatgcag
ttcctgtcccggatcgaggaaggcgaaaacctagattgcaccttcgataaagagacagag
ctcactcctcttgagtcagcgattggaatcctgcagctgattgcaaaagaattcagcgtg
cctgaaaagaagatagaactcatccacaaagtactgaaggaagctgctgttattgtctgc
ataaaaaacaaagagttcagtaaagctttggcagttttgaagagacatatggagaaggat
actggaaatcagaaaaagaggactgagttgcagactatcatccgggagaagaatcgtgct
catccaataatcaaagatttctcatatgtgaacttccagcagtatatgtttcagttcctg
aagacctacgtggatacctcagagcctctgctggtaacgatgatgaagagtctgaattca
gaacgtgctgaagaaccaaagcggtcatcggtgactcctgagtctccaagcaggacagag
gaccaggaagaagcttatgagcccttaagaagggtaaagcactcagtgggaactctaaga
cgtgcagaaactgcaggaggtgtggcgggagctccaagctgccctgaaatggcaaaggac
ccgacaggagctccagagcacgtaggaacagtgaaagatgcggtgagagctccctgccct
gctgaaagtacagaggattctcagggagctccaagatgtgcagaaaccgcaagagatgtg
atgggggctccaagtccctctgaaatgacaaaggacctgctaggagctccaaagtgtaca
gaaactgccagagatgtggtgagagcgcccagccctgctgagagcacaaaggacccagtg
ggcactccagggcatgcagaaacagcaagagatgtggcgagagctcccagccctgctgaa
acaacaaagaaccttccaggagctccagagtgtgcagacacagtgaaaaacacagtgaga
gcacccagccctgctgaaaggaggaaggaccttgtaagagctccaaagcgtgcagaaaca
gccagagatgtggtgagggcacccagccctgctgaaagggtgaaggacacagcgggcgct
tccgagcctatgaaaagtgctagttacccaacggcttctcagcctagaatagcagctgtt
aagagctccaaagttttttcagtacctgtggaaatatctgaacaaccggcagctgcagct
ccagtgcatgcaggagtgtcctccagggatctggaaaggacgccctttagaactgtaacc
acgtacggaatttctgttctgagagaagctttcaagatgctgtccaactccccggattca
gatgcactcttcaacaaactggatgaaacagacttgccttccccccagcaaatgtctcct
tctgtatcccacagaaccaagagacggaaagaagagaagaatcaaggttctgagacctta
gactctcctgaaataccccataagagcaaacgtttgttcactataagcaaaatgataatg
gaccaaggcagccagtgcagcaagtcaagtgaaagtccagactcttctcaggaacgcgtt
gtatcttctgcctatagacctgttcaggaattgcctgaccagcctgtatctactaaaagg
tcctctcaacaaaggtggaatagttcatatggtgaagaaagaaaagacagctggagtgat
gaagatgagctctttacagatgcagcattaactgagacaagcagcaacaactccacagtc
tatggttccaagaaacagaaatggacagtacaggaaagcgagtggatcaaagacggagtg
aggaagtatggagaagggaggtggaagaccatttctgagaaataccccttccagaaccgc
acatcagtgcagatcaaggatcgctatcggaccatgaaaaagctgggaatcgcctaa

DBGET integrated database retrieval system