KEGG   Gallus gallus (chicken): 395600Help
Entry
395600            CDS       T01006                                 

Gene name
CNMD
Definition
(RefSeq) leukocyte cell-derived chemotaxin 1
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: BRICHOS
Motif
Other DBs
NCBI-GeneID: 395600
NCBI-ProteinID: NP_990141
CGNC: 12720
Ensembl: ENSGALG00000016945
UniProt: Q9PUU8
Position
1
AA seq 347 aa AA seqDB search
MAEGSEKVPIARAGPEDVEQGLPPAYTAAVPPPGPGRLLKAGATVLIAGALLLLAGAIGA
FYFWKATERQVYNVHYTMSINGKVQDGSMEIDAGNNLETFKTGSGSEEAVEVHDFQIGIT
GIRFAGGEKCYIKAQPKARVPEVDAMTKASLSSDLEDEIMPVRFDENSLIWVAADEPIKH
NGFLSPKILELCGDLPIFWLRPTYPKDKQRERREMKRNKRQSESNFDAEHRAAAAEEVNT
RSTPTQLTQDLGPQSNETRPMQQESDQTLNPDNPYNQLEGEGMAFDPMLDHLGVCCIECR
RSYTQCQRICEPLLGYYPWPYNYQGCRTACRIIMPCSWWVARIMGVV
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggccgagggctcggagaaggtacccatcgcccgagcggggcccgaagacgtggagcag
ggcctgccgcccgcatatacggcagcagtgccccctccggggccagggcggctgctgaag
gcaggggccactgtgctcatcgctggggcccttctgctgctggctggggccatcggtgcc
ttctacttctggaaagccactgagaggcaggtctacaacgttcactacaccatgagcatt
aatggaaaagtgcaagacggatcgatggaaatagatgccggaaacaacttagagacattc
aaaacaggaagcgggagtgaagaggctgttgaagttcatgatttccagattggcatcacc
ggcatccgatttgctggaggagagaagtgttacatcaaggcccagcccaaagctcgtgtg
cctgaggtggatgccatgaccaaggccagcctgtcctctgacctggaagatgaaatcatg
cctgttagatttgacgaaaactctcttatctgggtggctgcagacgagcccatcaagcac
aacggtttcctaagccccaaaattttagagctttgtggggatcttccgattttctggctt
cgacctacatatcccaaagataaacaaagagaaaggagagaaatgaagagaaataaacgc
cagtccgagtcaaacttcgatgcagaacacagagcagctgctgctgaagaggtgaacacc
aggtccacccccacccagctgactcaagatcttggcccccagtcgaatgaaaccaggcca
atgcagcaagaaagcgatcaaacacttaacccagacaacccatacaaccaactggaaggt
gaagggatggcttttgaccccatgctggaccacctgggcgtgtgctgcatcgagtgcagg
cgaagttacacgcagtgccagaggatctgtgagcctctgctgggctactacccgtggcca
tacaactaccagggctgccgcactgcctgccgcatcatcatgccctgcagctggtgggtc
gctcgcatcatgggcgttgtgtga

DBGET integrated database retrieval system