KEGG   Gallus gallus (chicken): 395622
Entry
395622            CDS       T01006                                 

Gene name
ADMP
Definition
(RefSeq) anti-dorsalizing morphogenetic protein precursor
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 395622
NCBI-ProteinID: NP_990153
CGNC: 49407
Ensembl: ENSGALG00000037408
UniProt: Q9PVK1
Position
28
AA seq 364 aa
MLGTVLLLLLALARPAAPESRRAEALKKLLEVFGMEDPPPPPAHVKQPPQYMVDLFNAVA
NADGVTKNPDVLEGNTVRSFLDRTHGEKMRFLFVLSSVARNEKILTAELHLFRLWPRAAE
GPRRHHFCQVSVYQILDESEPDSPEGQKLLATRLLSLQGSGWEVFAITQAVRDWTQDESS
NRGLLVTVHGLGGSALEAPAVQFASSGDHHESKKPMLVLFTDDGRRGASLPMAGVPASQP
RDFPAKLSGPRSARSLDRLQPCQRHPLSVDFEEIGWSGWIISPRGYNAYHCRGSCPFPLG
ENMRPTNHATVQSIINALKLSEGVSSPCCVPDKLHSINLLYFDDDENVVLKQYDDMVAGS
CGCH
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgctgggcacggtgctgctgctgctgctggccttggcacggccggccgccccggagagc
cgcagggctgaggctctcaagaagctgctggaggtgttcggcatggaggaccccccgccc
ccccccgcccacgtcaaacagccgccgcagtacatggtggatctgttcaacgcggtggcc
aacgccgacggcgtcaccaaaaaccccgacgtcctggagggcaacaccgtccgcagcttc
ctggatagaactcacggcgagaagatgcggttcctcttcgtcctctccagcgtggccagg
aacgagaagatcctcacggcggagctgcacctcttccggctgtggccgagagccgccgag
gggcccaggaggcaccacttctgtcaggtcagcgtgtaccaaattctggacgagagtgag
ccagactcccccgaaggacagaagctgctggcaaccaggctgctctcgctgcagggctcg
ggctgggaggtctttgccatcacgcaggctgttcgggattggacccaagatgagagtagc
aaccgaggtttgctggtgacggtgcacggcctgggggggagcgcactcgaggcccccgcc
gtgcagtttgcatccagcggggaccaccatgagagcaagaagcccatgctggtcctgttc
acggacgatgggcgccgaggagcgtccctgcccatggccggagtcccagcctcacagcct
cgggatttccctgccaagctgagcggcccgcgcagcgcacgctccctggaccgcctgcag
ccgtgccagaggcaccccctgtccgtggacttcgaggagatcggctggtcggggtggatc
atctcaccccggggttacaacgcctaccactgcagaggctcctgccccttccccctgggt
gagaacatgcggccgaccaaccacgccaccgtgcagtccatcatcaacgccctgaagctg
agcgagggcgtcagcagcccctgctgtgtgcccgacaagctccactccatcaacctcctc
tactttgacgacgatgagaacgtggtccttaagcagtacgatgatatggtggcggggagc
tgcggctgccactga

DBGET integrated database retrieval system