KEGG   Gallus gallus (chicken): 395623Help
Entry
395623            CDS       T01006                                 

Gene name
CER1
Definition
(RefSeq) cerberus precursor
  KO
K01645  cerberus 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    395623 (CER1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAN Cys_knot Sclerostin DUF5374
Motif
Other DBs
NCBI-GeneID: 395623
NCBI-ProteinID: NP_990154
CGNC: 4048
Ensembl: ENSGALG00000005434
UniProt: Q9PUK2
Position
Z
AA seq 272 aa AA seqDB search
MSLLLLQLLVLSCLGDTEPQPDSQQRKRRPLQHLFYLDRNLLESQSFHELVGENPVGVKE
TQEEPSFFIAFPQTAGESQKQGEKKMSRFILPNAELYAHQDLRTWAAPKEISPVENFSPS
YYSNKRDVEPPYRKDAKKFWDHFMLRKNSASEEVVLPIKTNEMHQETCRTLPFSQSVAHE
SCEKVIVQNNLCFGKCSSFHVPGPDDRLYTFCSKCLPTKFSMKHFDLNCTSSVPVVKKVM
IVEECNCETQKIEDPLLGSLQSDFLGNVPEHN
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgctcctccttcagctgctagtgctctcgtgtcttggagacacagagccacag
ccagattcacagcaaaggaaaaggcggccacttcagcaccttttctatttggacagaaac
ttacttgaaagccagagttttcatgagttggtgggggaaaacccagtaggtgttaaggaa
acccaggaagagccaagcttttttatagcatttccacagacagcaggagagagtcagaag
caaggggagaaaaaaatgtccagattcatccttcctaatgcagaactctatgcacaccaa
gatctgagaacctgggcagcacccaaagagatctctcctgtggaaaacttctctccatcc
tactattccaacaagagggatgttgaacctccctatagaaaagatgccaaaaaattctgg
gaccatttcatgttaaggaaaaattcagcttctgaagaggttgtcctgccaatcaagacc
aatgaaatgcaccaagaaacttgcagaaccctgcctttttcccagagtgttgctcatgag
agctgtgagaaggtgatagtccagaacaatctatgttttggcaagtgtagttcctttcat
gttcctggtccagatgatcgtctttataccttttgttctaaatgcctgcccaccaagttt
tccatgaagcacttcgatctcaactgcaccagttctgtcccagtggtcaaaaaagtcatg
attgtggaagagtgtaactgtgagactcagaagatagaagatcctctgcttggatctcta
cagtcggattttcttggaaatgtacctgagcacaattaa

DBGET integrated database retrieval system