KEGG   Gallus gallus (chicken): 395625
Entry
395625            CDS       T01006                                 

Gene name
EFNB2
Definition
(RefSeq) ephrin-B2 precursor
  KO
K05463  ephrin-B
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    395625 (EFNB2)
   04052 Cytokines and growth factors [BR:gga04052]
    395625 (EFNB2)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   395625 (EFNB2)
Cytokines and growth factors [BR:gga04052]
 Growth factors
  Growth factors (RTK binding)
   395625 (EFNB2)
SSDB
Motif
Pfam: Ephrin TMEM132D_C RIFIN EphA2_TM ECSCR Amnionless
Other DBs
NCBI-GeneID: 395625
NCBI-ProteinID: NP_990155
CGNC: 66205
Ensembl: ENSGALG00000029175
UniProt: Q9PUJ4
Position
1
AA seq 333 aa
MAARRRDASACKYCWGALMVLWRTALAKSIVLDPIYWNSSNPKFLPGQGLVLYPQIGDKL
DIICPKVDSKTVGQYEYYKVYMVDKDQADSCAIRKDNTPLLNCAKPDQDVKFTIKFQEFS
PNLWGLEFQKNKDYYVISTSNGSLEGLNNQEGGVCQTKTMKILMKVGQDPNSAGLPRSTD
PTKRPEQEAGTNGKSSTTSPFVKDHSGSSTDGSKAGHSSILGSEVALFAGIASGCIIFIV
IIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVF
CPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggcagcgcggcggcgcgacgcctccgcctgcaagtactgctggggagccctcatggtt
ttatggagaactgcgctggccaagtccatcgttttagaccccatctattggaattcctcc
aaccccaagttccttcctggacaaggattggtactatatccacagataggagacaaactg
gatattatatgcccaaaggtggactctaaaactgttggccagtatgaatattataaggtc
tacatggttgataaagaccaagcagatagctgtgctattagaaaggacaatacacctcta
ctcaactgtgccaagccagatcaagatgttaagtttaccatcaaatttcaagaattcagc
cctaatctctggggcctggaatttcagaagaacaaagattattacgtcatatcaacatca
aatgggtctttggagggcctgaataaccaggagggaggggtgtgccagacaaaaaccatg
aagatcctcatgaaagttggacaagatcccaattctgcagggttacctcggagcacagac
ccaaccaagcgccctgaacaggaagctggtacaaatgggaagagctccaccacgagtccc
tttgtgaaggaccactcaggatctagcacagatggcagtaaggctgggcattccagtata
ctgggttcagaagtggccttatttgcaggaattgcatcagggtgcatcattttcatcgtc
atcatcatcactttggtggttctattattgaagtaccggagaagacacaggaagcattcc
ccacaacacaccacaactctctcacttagtacattagccaccccaaaacgcagtggcaac
aacaatggttctgagcccagtgacattatcattcctctaaggactgcagacagtgttttt
tgcccccactatgaaaaggtcagcggcgactatggacatccagtgtacatagtacaagag
atgcctcctcagagtccagcaaacatttactacaaggtctga

DBGET integrated database retrieval system