KEGG   Gallus gallus (chicken): 395679Help
Entry
395679            CDS       T01006                                 

Gene name
SMAD5
Definition
(RefSeq) mothers against decapentaplegic homolog 5
  KO
K16790  mothers against decapentaplegic homolog 5
Organism
gga  Gallus gallus (chicken)
Pathway
gga04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    395679 (SMAD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3 DUF4223
Motif
Other DBs
NCBI-GeneID: 395679
NCBI-ProteinID: NP_001014968
CGNC: 4741
Ensembl: ENSGALG00000006309
UniProt: Q56I99
Position
13
AA seq 465 aa AA seqDB search
MTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPG
QPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKE
VCINPYHYKRVESPVLPPVLVPRHSEFNPQHSLLVQFRNLSHNEPHMPHNATFPDSFQQP
NSTPFSISPNSPYPPSPASSTYPSSPASSGPSSPFQLPADTPPPAYMPPDDQMGQDNSQS
MDTSNTMIPQIMPNISTRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC
NYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcaatggccagtttgttctcctttactagcccagctgtaaagcgtctgttgggc
tggaaacaaggagatgaagaggaaaaatgggcagaaaaagctgtcgatgctttggttaaa
aagctgaaaaagaaaaaaggtgctatggaagaactggagaaagctttgagcagtccagga
cagcccagcaagtgtgttactatcccccgttcgttagatggacgacttcaggtttctcac
agaaaaggccttccccatgtaatttactgtcgggtctggcgttggcctgatctacaaagc
catcatgagctgaagccattggatatttgtgaatttccttttggatctaaacagaaggaa
gtctgcatcaatccttaccactataagagggtggagagcccagttctacctccagtgtta
gtgcctagacatagtgaattcaatccacagcacagtctactagttcagttcaggaaccta
agccacaatgaaccacatatgccacataatgcgacatttccagattccttccagcaaccc
aacagcactccattttccatttcgccaaacagtccctatccaccttctccagccagcagc
acttacccaagctccccagctagctctggaccatctagtccatttcagctacctgctgat
actccacctcctgcatatatgccccctgatgatcaaatggggcaggataactctcagtct
atggacacaagcaatacaatgatccctcaaatcatgccaaatatatctaccagagatgtt
cagcctgttgcctatgaagaacccaaacactggtgttcgattgtgtattacgaattaaat
aatcgtgttggagaggcctttcatgcatcttccacaagtgtcttagtagatgggtttaca
gatccctccaataataaaaacaggttctgcttgggtttgctctcaaatgttaatcgcaac
tcaacaattgagaacactagacgacatattgggaaaggagttcatctctactatgttggt
ggggaagtctatgctgagtgtttaagtgacagcagcatatttgtacagagcaggaactgc
aactaccaccatggctttcatccaacaactgtatgcaagattcctagtgggtgcagcctg
aaaatctttaacaatcaggaatttgctcagcttttagctcagtctgtcaaccatggattt
gaagcagtgtatgagctcaccaaaatgtgcaccatccgaatgagttttgtaaaggggtgg
ggagctgaatatcaccgacaagatgtcacaagcaccccatgctggatagaaattcatctt
catgggcccctccagtggctggataaagtacttacacaaatgggttctcctcttaatccc
atttcatctgtttcatag

DBGET integrated database retrieval system