KEGG   Gallus gallus (chicken): 395685Help
Entry
395685            CDS       T01006                                 

Gene name
WSB1
Definition
(RefSeq) WD repeat and SOCS box-containing protein 1
  KO
K10341  WD repeat and SOCS box-containing protein 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    395685 (WSB1)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     395685 (WSB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40 SOCS_box eIF2A Nup160
Motif
Other DBs
NCBI-GeneID: 395685
NCBI-ProteinID: NP_990203
CGNC: 4223
Ensembl: ENSGALG00000005668
UniProt: Q9W7K9
Position
19
AA seq 421 aa AA seqDB search
MASFPLSVNEKLIARSRAVGELLAPTSPFDKKCGRENWTVAFAPDGSYFAWSQGHRIVKL
VPWSQCLTNFLLHGTKNVANSANARLSRQNSDGSQRNKPCEHIIDCGDIVWSLAFGSSVP
EKQSRCVNIEWHRFKFGQDQLLLATGLNNGRIKIWDVYTGKLLLNLMDHTEVVRDLTFAP
DGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVYGCAFSPDSSILCSVGASKAVFL
WDMDKYSMIRKLEGHHNDVVACEFSPDGALLATASYDTRVYVWDPYIGVILREFGHLFPP
PTPIFAGGANDRWVRSVSFSHDGLHIASLADDKMVRFWRIDEEYPVQVAPLNNGLCCTFS
TDGSVLAAGTQDGSVHFWATPRQVSSLQHLCRMAIRRVMPTSQVKNLPTPSKVVEFLCYQ
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggccagctttcccctgagcgtcaacgagaagctcatcgcacggtcgcgggctgttgga
gaactcttggcccccacttctcctttcgacaagaagtgtggacgtgagaactggactgtt
gcgtttgctcctgatggatcctactttgcttggtcgcaaggacatcgtatagtgaagctg
gtcccctggtctcagtgccttactaacttcttgttgcatggcacaaagaatgttgcaaat
tctgccaatgcaaggctttcaagacagaacagtgacggcagtcagagaaacaagccctgt
gaacatataatagactgcggtgatattgtctggagtctggcttttgggtcttcagtgcct
gagaagcagagtcgctgtgtgaatatagaatggcatcgtttcaaatttgggcaggaccag
ctgctgcttgcaacaggcctgaacaatgggcgcatcaagatctgggatgtgtatacagga
aaactcctccttaacctgatggaccatacagaagttgtcagagatttaacgtttgcccca
gatggcagcctgattttggtgtctgcatccagagacaaaacactgagagtgtgggacctg
aaagatgacggaaatatgatgaaagtgttgagaggacatcagaactgggtatatggttgt
gcattctctccagattcttccattctctgttctgttggagctagtaaggcagtttttctc
tgggatatggataaatactccatgatacgaaaacttgaaggacatcacaatgatgttgta
gcctgtgagttttctcctgatggagctttactggctactgcatcctacgatactcgagtc
tatgtctgggatccatacattggagttattcttagggagtttgggcatctgtttccacct
cctacaccaatatttgctggaggtgcaaacgaccgatgggttagatcagtgtcttttagt
cacgatggactacatattgcaagccttgctgatgataaaatggtaagattctggagaatt
gatgaagagtaccctgtacaagttgcacctctgaacaacgggctctgctgtaccttttct
actgatggcagtgttctagctgcagggacacaggatggcagtgtgcacttctgggcaact
ccaagacaagtctctagtctccagcatttgtgtcgcatggcaattcgaagagtgatgccc
acaagccaagtcaagaacttgcctactccatcaaaagtggtggaatttctttgttaccag
atctga

DBGET integrated database retrieval system