KEGG   Gallus gallus (chicken): 395703
Entry
395703            CDS       T01006                                 

Gene name
WNT5A
Definition
(RefSeq) protein Wnt-5a
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
gga  Gallus gallus (chicken)
Pathway
gga04150  mTOR signaling pathway
gga04310  Wnt signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    395703 (WNT5A)
   04150 mTOR signaling pathway
    395703 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    395703 (WNT5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    395703 (WNT5A)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Heparin
  Morphogens
   395703 (WNT5A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 395703
NCBI-ProteinID: NP_990218
CGNC: 4029
Ensembl: ENSGALG00000034168
UniProt: Q9YGX6
Position
12
AA seq 385 aa
MEKSTAVLIQGGALGTLGSTMASQYLVVALAIFSSCTQVVIEASSWWSLGMNPMNPMNPV
QMSEVYIIGAQPLCSQLAGLSQGQKKLCQLYQDHMQFIGEGAKTGIKECQYQFRHRRWNC
STVDNNSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSSCGCSRAARPKDLPR
DWLWGGCGDNIEYGYRFAKEFVDARERERVYQRGSYESARIMMNLHNNEAGRRTVYNLAD
VACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMKLNSRGKLVQMNSRFNAPT
IHDLIYIDPSPDYCMRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQRERC
HCKFHWCCYVKCKLCTEIVDQFVCK
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggagaaatccactgcagtattaatccaaggaggtgctctggggacacttggcagcaca
atggcttctcagtacctcgtagtggctctggccatcttctcctcttgtacccaggttgta
atagaagccagctcttggtggtctctagggatgaaccctatgaaccccatgaaccctgtg
cagatgtcagaggtatatataataggagcccagccactatgtagccagctagcagggctt
tcccaaggacagaagaaactctgccagttgtatcaggaccatatgcagttcattggagag
ggtgcaaagaccggcattaaggaatgccagtatcagttcagacatagaagatggaattgc
agcactgtggacaacaactctgtttttggcagagtcatgcagataggcagccgggagacg
gcgttcacctacgcagtgagcgcggccggggtggtcaacgccatgagccgggcgtgccgg
gagggtgagctctcctcttgtggctgcagccgggccgcgcggcccaaggacctgccccgg
gactggctgtggggcggctgcggggacaacatcgagtacggataccgctttgccaaggag
tttgttgacgcccgggaacgggagagagtttaccagagaggctcctacgagagcgcccgg
atcatgatgaacctacacaacaatgaggctgggaggagaactgtgtacaacctggctgac
gtggcctgtaagtgccacggtgtctctggttcctgtagcctgaagacctgttggcttcag
cttgctgatttccgcaaggtaggcgatgccctgaaggagaaatatgatagtgctgctgcc
atgaagctcaacagccggggcaagctggtgcagatgaacagccgcttcaacgcacccacc
atccatgacctgatctacatcgatcccagccctgactactgcatgcgcaatgagagcacc
gggtccctgggcacccagggccgcctttgcaataagacctcagagggcatggacggctgt
gaactgatgtgctgcggccgggggtacgaccagttcaagacggtgcagcgagagcgctgc
cactgcaagttccactggtgctgctacgtgaaatgcaagttgtgcacagagatcgtggac
cagtttgtgtgcaaatag

DBGET integrated database retrieval system