KEGG   Gallus gallus (chicken): 395714
Entry
395714            CDS       T01006                                 

Gene name
BARX2
Definition
(RefSeq) homeobox protein BarH-like 2
  KO
K09361  BarH-like homeobox
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395714 (BARX2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, not assigned
    395714 (BARX2)
SSDB
Motif
Pfam: Homeodomain DUF5304
Other DBs
NCBI-GeneID: 395714
NCBI-ProteinID: NP_990227
CGNC: 813
Ensembl: ENSGALG00000029382
UniProt: Q9W694
Position
24
AA seq 267 aa
MHCPPQPRLAKAGRRRYKTFMIDEILSKETCDYFEKLSLYSVCPSLLVRPKPLHSCAGSP
SLRAYPLISVITRQPSVVPHLVPAATSSHVLPAQTSATASSETPASETHGSSESEAEQPT
PRLKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWYQNRRMK
WKKMVLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQSQEAEGSQAPEEPKVTEE
KPEVSLETEESPEHIAEPSSEEVTPLS
NT seq 804 nt   +upstreamnt  +downstreamnt
atgcactgcccgccgcagccccggctcgccaaggcaggcaggaggcgctacaagactttc
atgatcgacgaaattctctccaaggagacgtgcgattacttcgagaaactttccctctat
tccgtctgtccgtccctcctggtccggcccaagccgctgcactcctgcgcggggtcccct
tctctgagggcatatcctctcatctccgttatcaccaggcagccctccgtggtccctcac
ctcgttccggctgccaccagctcccatgtgctgccagctcagacctcagccaccgcgagc
tcggagacgccagccagcgagacccacggcagcagcgagtcggaggcagagcagcccaca
cctcggttaaaaaagccacgccggagtcggaccatcttcacagagctccaactgatgggc
ttggagaagaaattccagaagcaaaagtatttgtctacacccgacaggcttgacttagcg
cagtcgctggggctgactcagctccaggtgaagacgtggtaccagaaccgcaggatgaag
tggaagaaaatggtgttgaaaggtgggcaggaagctccaacaaagcccaaaggccgtcca
aagaaaaactccattcccacctcagaggaaattgaagcagaagagaaaatgaacagccag
gctcagagtcaggaggcagagggatctcaagcccccgaggagcctaaagtgacagaggag
aagccagaagtctctttggagacagaagagtctccagaacatatagcagagccctcctca
gaggaggttacgccattaagttaa

DBGET integrated database retrieval system