KEGG   Gallus gallus (chicken): 395715
Entry
395715            CDS       T01006                                 

Gene name
SERPINB10B
Definition
(RefSeq) heterochromatin-associated protein MENT
  KO
K13963  serpin B
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    395715 (SERPINB10B)
Peptidases and inhibitors [BR:gga01002]
 Peptidase inhibitors
  Family I4: serpin family
   395715 (SERPINB10B)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 395715
NCBI-ProteinID: NP_990228
CGNC: 49439
Ensembl: ENSGALG00000019553
UniProt: O73790
Structure
PDB: 
2H4P 2H4Q 2H4R 2DUT

Position
2
AA seq 410 aa
MEQVSASIGNFTVDLFNKLNETNRDKNIFFSPWSISSALALTYLAAKGSTAREMAEVLHF
TEAVRAESSSVARPSRGRPKRRRMDPEHEQAENIHSGFKELLTAFNKPRNNYSLRSANRI
YVEKTYALLPTYLQLSKKYYKAEPQKVNFKTAPEQSRKEINTWVEKQTESKIKNLLSSDD
VKATTRLILVNAIYFKAEWEVKFQAEKTSIQPFRLSKNKSKPVKMMYMRDTFPVLIMEKM
NFKMIELPYVKRELSMFILLPDDIKDGTTGLEQLERELTYERLSEWADSKMMTETLVDLH
LPKFSLEDRIDLRDTLRNMGMTTAFTTNADFRGMTDKKDLAISKVIHQSFVAVDEKGTEA
AAATAVIISFTTSVINHVLKFKVDHPFHFFIRHNKSKTILFFGRFCCPVE
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggaacaggtctcggcatcaattggcaactttacagttgatcttttcaacaagctgaat
gagaccaacagggacaaaaacattttcttttccccttggagcatatcatctgctctcgcc
ctgacatatctggctgcaaaaggcagtacagcaagagagatggcagaggttcttcatttc
actgaagctgtgcgagctgaaagctcttctgtggccagaccttctcgggggagaccaaaa
agaagaagaatggaccctgagcatgagcaagctgaaaacatccactctggattcaaagag
ctcctgacagccttcaacaaacccagaaacaactactcgctgagaagtgccaaccgtatc
tatgtggaaaaaacctacgcattgctgcctacatatctacagctcagtaagaagtactat
aaggcagagccacagaaggttaactttaagacagcaccggaacaatccagaaaggaaatc
aacacctgggtggaaaaacaaaccgagagtaaaataaagaatttgctgagttcggatgat
gtgaaagccaccactaggttgatcttggtcaatgccatttacttcaaggcagaatgggaa
gtgaaatttcaggcagaaaaaacatctatacaacccttccgactgagcaagaacaagtcc
aagcccgtgaagatgatgtatatgagagatacatttccagttcttatcatggaaaaaatg
aacttcaaaatgattgagcttccatacgtgaaacgtgaactcagtatgttcatcctactt
cctgacgacatcaaagatggtactacgggtcttgagcagctggaaagagaactcacctac
gagaggctgtcagaatgggctgattcaaagatgatgacagaaactcttgtggatctgcac
ctgcctaagttctcactggaggacagaattgacctccgtgatactctgagaaacatggga
atgacaactgccttcacaaccaatgctgatttcagagggatgactgataagaaggatttg
gctatttccaaagtcattcaccagtcttttgttgcagttgatgagaaaggcactgaggca
gctgctgctacagctgtaattatatcattcacaacttcagttatcaatcatgttctgaaa
tttaaggttgatcaccctttccacttcttcatcagacataacaaatccaaaacaatcctg
ttttttggcagattctgctgcccagtagaataa

DBGET integrated database retrieval system