KEGG   Gallus gallus (chicken): 395740
Entry
395740            CDS       T01006                                 

Gene name
PAX9
Definition
(RefSeq) paired box protein Pax-9
  KO
K09382  paired box protein 1/9
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395740 (PAX9)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Paired box domain only
    395740 (PAX9)
SSDB
Motif
Pfam: PAX HTH_23 HTH_32 HTH_29
Other DBs
NCBI-GeneID: 395740
NCBI-ProteinID: NP_990243
CGNC: 49451
Ensembl: ENSGALG00000010114
UniProt: F1N8W6
Position
5
AA seq 341 aa
MEPAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARY
NETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSV
SSISRILRNKIGNLSQQGHYESYKQHQPPPQPPLPYNHIYSYPSPIAAAGAKVPTPPGVP
AIPGTMAMPRTWPSSHSVTDILGIRSITDQVSDTSSYPSPKVEEWSSLGRSSFPAAAQHA
VNGLEKSSLEQEAKYSQAHNGLPAVGSFVSAPAMSPYATSAQVSPYMPYSAAPSSYMAGH
GWQHTAGTPLSPHGCDLPASLAFKGVQTAREGSHSVTASAL
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggaacccgccttcggggaggtgaaccagctcgggggggtgttcgtcaacgggaggccc
ctgcccaacgccatccggctccggattgtggaactggcacagctggggatcaggccctgc
gacatcagccgccagctccgcgtttcccacggctgtgtgagcaaaatcctggctcgctac
aacgagaccggctccatcctaccgggggctatcggaggcagcaagccgcgggtcaccacc
cccacggtggttaaacatatccggacctacaaacaaagggatccgggcatcttcgcctgg
gagatccgggatcgcctgctggccgacggcgtgtgcgacaagtacaacgtgccgtcggtc
agctctatcagccgcatcctccgcaacaagatcggaaacctgtcccagcagggccactac
gagtcctacaagcagcatcagccgcccccgcagccgcccctgccctacaaccacatctac
tcctaccccagccccatcgctgccgcgggagccaaggtgcccacgcctccgggagtgcct
gccatccctggtaccatggccatgcctcgcacctggccttcgtcccactcggtgacggac
atcctgggcatccgctccatcacggaccaagtgagcgacacctcgtcgtaccccagcccc
aaggtggaggagtggagcagcctgggccggagcagcttccccgctgcagcccagcatgcc
gtgaacgggctggagaagagctccctggaacaggaggccaagtacagccaggcacacaat
ggcctcccagcagttggaagctttgtatcagcaccagccatgtctccctacgccacgtcg
gctcaggtgtcaccctacatgccatacagcgcagctccctccagctacatggcaggccat
ggttggcagcatactgcaggcacgcctctctcccctcatggctgtgacctccctgcctcg
ctggccttcaagggcgtgcagacagccagggaaggcagccactcagtcacggcctccgct
ctctga

DBGET integrated database retrieval system