KEGG   Gallus gallus (chicken): 395747
Entry
395747            CDS       T01006                                 

Gene name
ETV4
Definition
(RefSeq) ETS translocation variant 4 isoform X1
  KO
K15592  ets translocation variant 4
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395747 (ETV4)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    395747 (ETV4)
SSDB
Motif
Pfam: ETS_PEA3_N Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 395747
NCBI-ProteinID: XP_015154936
CGNC: 807
Ensembl: ENSGALG00000036678
Position
27
AA seq 443 aa
MKGYVDQQVPFTFPQPPPGHAGSGCRTPTGAAKSPMEPGLLPAQDSEDLFQDLSQFQETW
LTEAQVPDSDEQFVPDFHSENLAFHSPPAKIKKEPQSPSSDPTLSCNHKQPFQYRNGEQC
LYASAYDQPRPVGIKSPDPGTPIQSPLQQFPRQDRNFLTPSGPPHPTSSCGYLIENSSAY
QPPVEMCHSFPSSQGMAQDAPIAYQRPMSEQCLQFPPQGFKQEFHDPQYEQAGSSCQYPA
AVVIKQEQVDYMYDSGCSYDKQMRPFADDVCVVPEKFEAGDIKQEVGGYREGPPYQRRGS
LQLWQFLVALLDDPTNSHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLR
YYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAELERQISEEDTVPLSHLD
ESTAYLPDLGSLPPQLYGKGYTY
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgaaggggtacgtggaccagcaggtgccgttcactttccctcagccgccgccgggccat
gcgggctccgggtgccggactccgacgggcgctgcgaagagccccatggagccgggcttg
ctgccggcgcaggattcggaagacctcttccaggacttgagccagttccaggagacttgg
ctgacagaagctcaggttccagacagcgatgagcaatttgtgcctgacttccattcagaa
aacctagcttttcatagtcctcctgcaaagattaaaaaggaaccacagagtccctcctcg
gaccccacgctgtcctgcaaccacaagcagccattccagtaccgcaatggagagcagtgc
ctttatgccagtgcctatgatcaacccagaccggttgggatcaaatcccctgacccagga
accccaatccagtcaccgctccagcagttccccagacaggacaggaacttcctgacccct
tcagggccaccccaccccacatccagctgtggatacctcattgaaaacagctctgcctac
cagccacctgtggagatgtgccactccttcccctcctcccagggcatggcccaggatgct
cccatcgcctaccagcgccccatgtctgagcaatgccttcagttccccccgcagggcttc
aagcaggagttccatgacccacagtatgagcaggcgggcagcagctgccagtacccagca
gccgtggtcatcaagcaggagcaggtggactacatgtatgactcaggctgcagctatgac
aagcagatgaggccctttgctgacgatgtctgcgttgttccagaaaaatttgaagcaggt
gacatcaagcaggaggtcggagggtaccgggagggccctccctatcagcggaggggatct
ctccagctctggcagttccttgtggctctattggatgatcccaccaactcccacttcatt
gcctggactggaagagggatggagttcaagctgattgagccagaagaggtagccaggctg
tggggcatccagaagaaccggccagccatgaactacgacaagctgagccgctctcttcgc
tactattatgagaaaggcatcatgcagaaggtggcaggggaacgctacgtctacaagttt
gtgtgtgagcccgaggctctgttctctctggccttccctgacaaccagcggccggccctg
aaggcagagctggagaggcagatcagcgaggaggacacggtgcctctgtcccacctggat
gagagcactgcttacctgcctgaccttgggagcctccccccgcagctctatggcaaaggc
tacacctactag

DBGET integrated database retrieval system