KEGG   Gallus gallus (chicken): 395749
Entry
395749            CDS       T01006                                 

Gene name
ETV5
Definition
(RefSeq) ETS translocation variant 5
  KO
K15593  ets translocation variant 5
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395749 (ETV5)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    395749 (ETV5)
SSDB
Motif
Pfam: ETS_PEA3_N Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 395749
NCBI-ProteinID: NP_001280024
CGNC: 4300
Ensembl: ENSGALG00000005768
UniProt: F1NEG9
Position
9
AA seq 507 aa
MDGFYDQQVPFMGPGKSCAEEGRGRLGSERKRKFLETDLAHDSEELFQDLSQLQEAWLAE
AQVPDDEQFVPDFQSDNLVLHAPPPAKIKRELHSPSSELSACSHEQALCASYGDKCLYNC
CAYDRKPPAGFKPLTPPATPVSPAQPGSSLPPPPAPGVQAAAHGGPAAPLRSTAPAPHLL
QEQRQQTFAVPRPPHPPVHMPKMMSENQYPTEHRFQRQMSEPCHPFPPQPGVPGDSRPVY
HRQLSEPVGPTAPHPAQGFKQEYHDPLYEHAGPSLPGPPGHGFQSPMGIKQEPRDYCIDS
EVPNCQSSYVRGGLFPSSHDGFSYEKDTRLYFDDTCVVPERLEGKVKQEPTLYREGPPYQ
RRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLS
RSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAYPDNQRPFLKAEPDCHVSEEDTLPL
THFEDSPAYLLEVEHCGSLPYAEGFAY
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggacggcttctacgaccagcaggtccccttcatgggccctgggaaatcctgtgccgag
gagggccgaggccggttgggctccgagaggaaaaggaagtttttggagaccgacctggcc
cacgactcggaagagctcttccaggatctcagccagctgcaggaggcctggctagctgaa
gctcaggtccccgacgatgaacaatttgtcccagatttccagtctgacaacctggtcctg
catgccccacctccagccaagatcaagcgggagctgcacagcccttcctcagagctgtcg
gcctgcagccacgagcaggctctctgtgccagctacggagacaagtgcctctacaactgc
tgtgcctacgacaggaagccccccgctgggttcaagccattaacaccgcccgccacgccg
gtgtcccccgcgcagccgggctcgtccctgccaccgccgccggccccaggagtgcaggca
gctgcccatggcggcccagctgccccactgcgcagcaccgcgccggcaccacacctgctg
caggagcagaggcagcaaaccttcgccgtgccgcggccgccccacccgcccgtgcacatg
ccaaagatgatgtccgaaaaccaataccctacagagcacaggttccaaaggcagatgtct
gagccctgccaccccttcccaccacaacccggcgttcccggggacagccgccccgtctac
caccggcagctgtcggaacccgttggccccaccgccccccaccccgctcagggattcaaa
caggagtaccacgacccgctctatgagcacgccggccccagcctgcccggcccccccggg
cacggcttccagtcccccatgggcatcaagcaggagccccgggactactgcatcgactca
gaagtgcctaactgccagtcctcatatgtgagagggggcctcttccccagcagccacgat
ggattctcgtatgaaaaagacacacgattgtattttgatgacacgtgcgtggtaccagag
agactggagggtaaggtgaagcaggagcccaccctgtaccgcgagggccctccctaccag
cggcgtgggtcgctgcagctctggcagttcctcgtcacgctcctggacgaccccgccaac
gctcacttcatcgcctggaccggccgcggcatggagttcaagctgatcgagcccgaggag
gtagcacggcgctggggcatccagaagaaccggccggccatgaactacgacaagctgagc
cgctccctgcgctactactacgagaagggcatcatgcagaaggtggccggcgagcggtac
gtctacaagttcgtgtgtgaccccgatgccctcttctccatggcgtaccccgacaatcag
cggcccttcctgaaagcggagcccgactgccacgtgagcgaggaggacaccctgccgctg
acgcactttgaggacagccctgcctacctgctggaggtggagcactgcggcagcctgccc
tacgcggagggctttgcctactga

DBGET integrated database retrieval system