KEGG   Gallus gallus (chicken): 395750
Entry
395750            CDS       T01006                                 

Gene name
ETV6
Definition
(RefSeq) transcription factor ETV6
  KO
K03211  ETS translocation variant 6/7
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395750 (ETV6)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    395750 (ETV6)
SSDB
Motif
Pfam: Ets SAM_PNT SAM_3 HSF_DNA-bind SAM_1
Other DBs
NCBI-GeneID: 395750
NCBI-ProteinID: NP_001186202
CGNC: 9785
Ensembl: ENSGALG00000012921
UniProt: F1NRC2
Position
1
AA seq 451 aa
MSEPAAQCCIKQERISYTPPASPVPNYTSSSPLHVPVPRAIRMEEDTIRLPAHLRLQPVY
WSRDDVAQWLRWAEKEFSLRPIESNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHI
LKQRKSRMLFSPFFHPGNSIHAQSEVLLHQNHDEDSFVQRPSRPSTEAVHHSTPTIELLH
RSRSPITNNHRPSPDSDQRPLKSPMDNTVRHLSPADRVPGARYHQENNHQEPYPLSVSPI
ENNHCPPPPEVLQKPSSPRQENTRVIQLMPSPIMHPLILNPRHSDFKPPRLSEDGLHREV
KPINLSHREELAYMNHIMVSVSPPEDHAMPIGRIADCRLLWDYVYQLLSDSRYENFIRWE
DKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMK
TPDEIMSGRTDRLEHLESQALDEQIYQEDEC
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgtctgagcctgctgcccagtgctgcatcaagcaagagagaatttcgtacacacctcca
gccagcccagtaccaaattacacttcctcgtcaccactacatgtcccagtgcctcgagcg
atcaggatggaggaagacacgatcagactgccggcacacctgcgtttgcagcccgtttac
tggagcagggacgacgtcgcacagtggctcaggtgggcggagaaggagttttccctgagg
ccgatcgagagcaacacttttgagatgaatggcaaggctctgttgctcctgaccaaagag
gactttcgatacagatctcctcattcaggtgatgttctgtatgaactccttcagcatatt
ctgaagcaaaggaagtctcgtatgctgttctcacctttcttccatcctgggaactctatc
catgctcagtcggaggttttattacatcaaaaccatgatgaagatagctttgtccagaga
ccttcaagaccatccacagaagcagtccaccacagcaccccaaccattgaactgttgcat
cgttctagatcacccatcaccaacaaccaccgtccatcaccagattccgatcagcggcca
ctgaagtcgcctatggacaacactgtccgtcacctctccccagccgacagggtgccaggg
gcaaggtatcatcaagagaacaaccaccaggagccctatcctctctcagtgtccccgata
gaaaacaaccactgcccacctcctcctgaggtgcttcagaagccctccagccctcgccag
gagaacaccagggtcatccagctgatgcccagtcctatcatgcatcctttgatactgaac
cccaggcactctgatttcaaaccaccgaggttgtctgaggatgggctgcacagggaggta
aagccaatcaacctgtcccaccgagaagagttagcttatatgaaccacatcatggtgtct
gtatctcctcctgaggaccatgcaatgccaattggaagaatagcagactgtaggttgctt
tgggattatgtttatcagctgctttctgacagccggtacgaaaatttcatccgatgggaa
gataaggaatccaaaatttttcggatagtggatcccaatgggctggcccggctgtgggga
aaccacaagaacagaacaaatatgacttatgagaaaatgtccagagccctacgccattac
tacaaactaaatattatccggaaggagccaggacaaaggcttttgttcaggttcatgaag
accccagatgagattatgagtggccgaacagaccgccttgagcaccttgaatcccaggca
ctggatgaacaaatataccaagaagatgagtgctga

DBGET integrated database retrieval system