KEGG   Gallus gallus (chicken): 395754Help
Entry
395754            CDS       T01006                                 

Gene name
NEUROD1
Definition
(RefSeq) neurogenic differentiation factor 1
  KO
K08033  neurogenic differentiation factor 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395754 (NEUROD1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    395754 (NEUROD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neuro_bHLH HLH Nop14 YL1 CDC45 DNA_pol_phi Nop53 DUF3438 Drc1-Sld2 DUF3499
Motif
Other DBs
NCBI-GeneID: 395754
NCBI-ProteinID: NP_990251
CGNC: 6765
Ensembl: ENSGALG00000008908
UniProt: P79765
Position
7
AA seq 357 aa AA seqDB search
MTKSYSESGPAGEPQAQAPPGWAAGCLSPPADGPEADKKEEDLEALHGEAEEDALRNGEE
EDEEDELDEEEEEEEEEEDDEQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGL
NAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLS
QPTTNLVAGCLQLNPRTFLPEQSADAAPHLPPAGAPFAPPPFPYASPGLPSPPYGTMDSS
HLFHLKPPHAYGAALEPFFEGGLPEGAGPAFDGPLSPPLSIYGNFSFKHEPAADFDNSYA
FTMHYPAGPLPAAPAHAAVFSGAAARCELPADGLAPYEGHPHHERVLSAQLSAIFHE
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagtcgtacagcgagagcgggccggcgggcgagccgcaagcgcaagcccccccc
ggctgggcggcagggtgcctgagcccgcccgccgacgggcccgaggccgacaagaaggag
gaggacctggaggctctgcacggcgaggctgaagaggacgcgctgcggaacggcgaggag
gaggacgaggaggacgagctggacgaggaggaagaggaagaggaggaagaggaggacgac
gagcagaagcccaagcggcgcggccccaagaagaagaagatgaccaaggcgcgcctggag
cgcttcaagctgcgccgcatgaaggccaacgcgcgggagcgcaaccgcatgcacggcctg
aacgcggccctggacaacctgcgcaaggtcgtgccctgctactccaagacgcagaaactc
tccaagatcgagacgctgcgcctggccaagaactacatctgggcgctgtctgagatcctg
cgctccggcaagagccccgacctggtctcattcgtgcagacgctgtgcaagggtctctcg
cagcccaccaccaacctggtggccggctgcctgcagctcaacccgcggacgttcctgccc
gagcagagcgcggacgccgccccgcacctgccgcccgcgggagcgcccttcgctccgccg
cccttcccctacgcgtcgccggggctgcccagcccgccctacggcaccatggacagctcc
cacctcttccacctcaagccgccgcacgcctacggcgccgcgctcgagcccttcttcgag
ggcggcctgcccgagggcgccggccccgccttcgacggcccgctcagcccgcccctcagc
atctacggcaacttctctttcaagcacgaacccgccgccgacttcgacaatagctacgcc
ttcaccatgcactaccccgccgggccgctgcccgccgcgcccgcccacgccgccgtcttc
tcgggcgccgccgcccgctgcgagctgcccgccgacggcctggcgccctacgaggggcac
ccgcaccacgagcgcgtcctgagcgcgcagctcagcgccatcttccacgagtga

DBGET integrated database retrieval system