KEGG   Gallus gallus (chicken): 395759
Entry
395759            CDS       T01006                                 

Gene name
SLC8A3
Definition
(RefSeq) sodium/calcium exchanger 3 precursor
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
gga04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    395759 (SLC8A3)
   04020 Calcium signaling pathway
    395759 (SLC8A3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    395759 (SLC8A3)
   04261 Adrenergic signaling in cardiomyocytes
    395759 (SLC8A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    395759 (SLC8A3)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    395759 (SLC8A3)
Transporters [BR:gga02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   395759 (SLC8A3)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Heparin
  Others
   395759 (SLC8A3)
SSDB
Motif
Pfam: Calx-beta Na_Ca_ex Na_Ca_ex_C Acyl_transf_3
Other DBs
NCBI-GeneID: 395759
NCBI-ProteinID: NP_001280026
CGNC: 7148
Ensembl: ENSGALG00000009400
UniProt: F1P023
Position
5
AA seq 922 aa
MAWLSLQPLTSAFLHFGLVTFVLFLHGLQVDAGLTGDSTSSVQNSSCSGSFDCKEGVILP
IWYPENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEKEITIKKPNGET
TTTTIRIWNETVSNLTLMALGSSAPEILLSLIEVCGHGFVAGDLGPSTIVGSAAFNMFII
IAICVYVIPDGETRKIKHLRVFFVTAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFFF
PLCVLLAWIADRRLLFYKYMHKKYRTDKHRGIIIESEGDHPKGIEMDGKMMNSHFLDGNL
VTVEGKEVDESRKEMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATRM
MTGAGNILKKHAAEQAKKSTSLHEVRPDEPEEFISKIYFDPCSYQCLENCGAVLLTVVRK
GGDVSKTIYVDYKTEDGSANAGADYEFTEGTVVLKSGETQKDFAVGIIDDDIFEEDEHFF
VRLSNLRVVDNEEPPELGNSPYPKAILASPCVATVTILDDDHAGIFTFECDVIHVSESIG
VMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDAYGELEFKNDETVKTIHIKVIDDE
EYEKNKSFFIELMSPRMVDMSLQKALLLTQEVAERKLTVEEEEAKRIAEMGKPILGEHPK
LEVIIEESYEFKSTVDKLIKKTNLALVVGTHSWRDQFLEAITVSAAGDEDEDESGEERLP
SCFDYVMHFLTVFWKVLFACVPPTEYCNGWACFVVSILIIGMLTAVIGDLASHFGCTIGL
KDSVTAVVFVAFGTSVPDTFASKAAAIQDVYADASITNVTGSNAVNVFLGIGLAWSVAAI
YWASQGQEFQVSAGTLAFSVTLFTIFAFICISVLLYRRRPHLGGELGGPRGCKLATTLLF
VSLWLLYILFATLEAYCYIKGF
NT seq 2769 nt   +upstreamnt  +downstreamnt
atggcgtggttaagcttgcagcctctcacctcagccttcctccattttgggctggttact
tttgtgctgtttttgcatggtttgcaggtggatgctggcctgacgggagactcaaccagt
tcagtacaaaacagctcgtgttcaggatcttttgactgcaaggaaggtgttatcctgcca
atatggtacccagaaaatccatcccttggggacaaaattgcccgtgttattgtatacttt
gtagcactgatctacatgttccttggagtctccatcattgcagatcgtttcatggcatct
atagaggtcattacatcgcaagagaaagaaatcacgattaagaaacccaatggagagacc
acaacaacaaccattcggatttggaatgaaactgtttccaacttgactctcatggctctg
ggctcctctgctcctgagatccttctgtctttgatagaagtgtgtgggcatggattcgta
gctggagacctggggccgtctacaattgttggcagtgctgccttcaatatgtttatcatc
attgccatctgtgtctacgtgatccctgatggggaaaccagaaagataaaacacctgaga
gttttctttgtcacagctgcttggagcatctttgcttacatctggttgtacatgatcctt
gctgtcttctctccaggtgtggttcaggtttgggaaggtctgctcacgcttttcttcttt
ccactttgtgttcttctggcttggatagcagacaggcgcctgcttttctataagtatatg
cacaaaaagtaccgtactgacaagcacaggggcattatcatagaatcagaaggtgatcac
cctaagggaattgagatggatggcaagatgatgaactcccactttctggatggaaactta
gtgactgtggaggggaaagaggtagatgaatctcgcaaagagatgatccggatccttaag
gatctgaagcagaaacacccagaaaaggatttggaccagctggtagaaatggctaactac
tatgccttgtcacatcagcagaagagcagagccttttatcgcattcaggctaccagaatg
atgacaggggctggcaatatcctgaagaagcatgcagctgagcaagccaagaagagcacc
agcttgcacgaagtgaggccggatgagcctgaggaattcatctccaaaatttattttgac
ccatgttcctatcagtgtctcgagaactgtggtgccgttctcctgacggtggtgcggaaa
ggaggggatgtgtccaagaccatctatgtggactataaaactgaggatggctctgccaat
gctggtgctgactatgagttcacagaggggactgttgtcttgaaatcaggggagacccag
aaggactttgcggtgggaattattgacgatgacatctttgaggaggatgaacatttcttt
gtgcgtctcagtaacctccgtgtggtggacaatgaggaacctccagagctcggtaactcc
ccatacccaaaggccatactggcttctccttgtgtggccacagtgactatcttggatgat
gaccatgctggcatcttcacgtttgagtgtgatgttatacatgtcagtgagagcattggt
gtgatggaagtcaaagtcctaaggacatcaggtgctcggggtacagtcatagtgccattt
aggacagtagaaggaacagcaaaaggaggtggagaagactttgaagacgcttacggggag
ctggagttcaagaatgatgaaactgtcaaaacaattcacatcaaagtaattgatgatgag
gagtatgaaaaaaacaagagtttcttcattgagctgatgagcccccgcatggtggatatg
agtttacagaaagctctgctgctcacccaagaagtggccgagaggaagctgacagttgaa
gaagaggaagccaagaggattgcagagatgggcaaaccaatacttggcgaacaccccaaa
ctagaagtcatcattgaggagtcctatgagttcaagagcactgtggacaagctcattaag
aagacaaacctagctttggttgtagggacacattcctggagggaccagtttttggaggcc
atcaccgtcagtgcagcgggtgatgaagatgaggatgagtctggggaagagcgcctgcca
tcctgcttcgactacgtgatgcacttcctgactgtcttctggaaggtgctgtttgcctgc
gtgccccccaccgagtactgcaatggctgggcctgcttcgttgtttccatcctcatcatt
ggcatgctcacagctgtcatcggtgacctcgcctcccacttcggctgcaccatcggcctc
aaggactcggtgaccgccgttgtgtttgtagccttcggcacctccgtaccagacacgttc
gccagcaaagctgcagccatccaggacgtgtatgccgacgcctcaatcaccaacgtcaca
ggcagcaacgccgtcaacgtcttcctgggcattgggctggcatggtcggtggcagcaatc
tactgggcgtcacaggggcaggagttccaggtgtcagccggcaccctggccttctctgtc
accctcttcaccatcttcgccttcatctgcatcagcgttctcctctaccgtcggcggccc
cacctcgggggagagctgggcggtccccggggttgcaaactggccacgacattgctcttc
gtcagcctgtggctgctgtacatcctctttgccaccctggaggcctattgctacatcaag
gggttttag

DBGET integrated database retrieval system