KEGG   Gallus gallus (chicken): 395765Help
Entry
395765            CDS       T01006                                 

Gene name
NPPA
Definition
(RefSeq) natriuretic peptides B precursor
  KO
K12334  natriuretic peptide A
Organism
gga  Gallus gallus (chicken)
Pathway
gga04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    395765 (NPPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANP ABC_tran_CTD
Motif
Other DBs
NCBI-GeneID: 395765
NCBI-ProteinID: NP_990256
CGNC: 49466
Ensembl: ENSGALG00000004574
UniProt: P18908
Position
21
AA seq 140 aa AA seqDB search
MDTRGSFSCGFLLLLLIQLQPSRANPIYNLSPAKELASMEALLERLEDKFALIEALESNP
DLQEPQTQEEIPPELTDDSDEQKAEPKLASNTPLSYRNPFLKRLRGVQMPRMMRDSGCFG
RRIDRIGSLSGMGCNGSRKN
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggacactagaggttcattttcctgtggtttcctcttgctgcttctcatccagctgcag
cccagcagagccaaccccatctacaacctcagccctgccaaagaactggccagcatggag
gctcttctggagagactggaggataagtttgcactgattgaagccctggagtccaatcct
gacctgcaagagcctcaaacccaagaggagatcccaccagaactcacagatgacagcgat
gagcagaaggctgaacccaagctagcatccaacactcctctgtcctacaggaaccccttc
ctcaagagactgaggggggtgcagatgcccaggatgatgagagattctggctgcttcggc
agaagaattgataggattggctccttgagtggaatgggttgcaatggttccaggaagaat
tag

DBGET integrated database retrieval system