KEGG   Gallus gallus (chicken): 395766Help
Entry
395766            CDS       T01006                                 

Gene name
USP2
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 2 isoform X1
  KO
K11833  ubiquitin carboxyl-terminal hydrolase 2 [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     395766 (USP2)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   395766 (USP2)
Ubiquitin system [BR:gga04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    395766 (USP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1
Motif
Other DBs
NCBI-GeneID: 395766
NCBI-ProteinID: XP_015153680
CGNC: 5097
Ensembl: ENSGALG00000006755
UniProt: Q9YHZ2
Position
24
AA seq 550 aa AA seqDB search
MSQLSSTLKRYVDSSRYAENTYSKMPSGYSSYTSYGSTYAYADRDKIGFKSSYLPSPRYH
HSRLSPTGGYDSGRLPLYPDSSIRLSPAYIRTQAPGGGLSGGSCYSFTGTPGSPSGYVST
STLLSRRRAVSHSDLAQEFSGLHTSDSAYAPSPSALYQAATRSDYVRDYLEKSSHCSLPS
SPSSSQLCERDDGYGGTHGPDPTSSKVVQGLTGLRNLGNTCFMNSILQCLSNTKELRDYC
LQNQYLRDLNNNSRMRTALMSEFAKLIQLLWTSSPNDSVSPSEFKTQIQRYAPRFVGYNQ
QDAQEFLRFLLDGLHGEVNRVLVRPRANADTLDHLPDDEKSRQMWRRYQEREDSRVSDLF
VGQLKSSLTCSECGYCSTAFDPFWDLSLPIPKKGYGEVTLMDCLRLFTKEDVLDGDEKPT
CCRCKARTRCTKKFSIQKFPKILVLHLKRFSEARIRASKLTTFVNFPLKDLDLREFASQS
CNHAVYNLYAVSNHSGTTMGGHYTAYCKSPISSEWHSFNDSRVTPMSSSHVRSSDAYLLF
YELASPSSRM
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagctctcctccacactgaaacggtacgttgactcgtcccgctatgccgagaac
acctacagcaagatgcccagcggctacagctcctacacctcctacggctccacctatgcc
tatgcagacagagacaaaatcggcttcaaatccagctacctgccctcccctcggtaccac
cacagcagactgtccccaaccggcggctacgacagcggccgcctgcccctgtaccccgac
tccagcatccgcctgagccccgcttacatccgcacacaggcgccgggcggggggctgagc
gggggctcgtgctactccttcaccgggacccccggcagcccctctggctacgtgtccacc
tccacacttctcagccgtcgcagagccgtcagccactcggacctggcgcaggagttttcg
gggctgcacacgtcggatagcgcctacgcacccagccccagtgccctgtaccaggctgcc
acgcgctccgactacgtccgcgattacctggagaagagcagccactgcagcctgccctcc
agcccctccagcagccagctctgtgaaagggatgatggttatggcggcacgcatggcccc
gaccccacgagctccaaggtggtgcaggggctgactgggctgcggaacctcggcaatacg
tgcttcatgaactccatcctgcagtgcctgagcaacaccaaggagctgcgggattactgc
ctgcagaaccagtacctgcgggacctcaacaacaacagccgcatgcgcaccgcgctcatg
tcagagtttgcaaagctgatccagctgctctggacctcatcccccaatgacagcgtgagt
ccctccgagttcaagacgcagatccagagatacgccccacgctttgttggatacaaccag
caggatgcacaggagttcctgcgcttcctcctggatgggctgcacggcgaggtgaaccgc
gtgctggtgcggccgcgggccaatgctgacaccttggaccacctccctgatgatgagaag
agccgccagatgtggcggaggtaccaggagcgggaggacagtcgtgttagtgatctcttc
gttgggcagctgaagagctcgctgacctgcagtgagtgtggctactgctccacagccttt
gaccccttctgggacctctccctgcccatccccaagaaaggctatggggaagtgaccctg
atggactgcctgcggctcttcaccaaagaggacgttctggatggggatgagaaaccgacg
tgctgtcgctgcaaagccaggacgcgatgcaccaagaaatttagcatccagaagttcccc
aagatcctggtgctccacctgaagcgcttctcagaggccaggatacgagccagcaagctc
accaccttcgtcaacttcccactgaaggacctggacctgagggagttcgcctcgcagagc
tgcaaccacgccgtttacaacctctacgccgtctccaaccactcgggcaccaccatgggg
ggacactacactgcctactgcaagagccccatctccagcgagtggcacagcttcaacgat
tcccgcgtcacccccatgtcctccagccacgtgcgcagcagcgatgcctacctgctcttc
tacgagctggccagcccatcctcacgcatgtag

DBGET integrated database retrieval system