KEGG   Gallus gallus (chicken): 395768
Entry
395768            CDS       T01006                                 

Gene name
MNX1
Definition
(RefSeq) motor neuron and pancreas homeobox protein 1
  KO
K08025  homeobox protein HB9
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395768 (MNX1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Eve
    395768 (MNX1)
SSDB
Motif
Pfam: Homeodomain QLQ Pox_Ag35
Other DBs
NCBI-GeneID: 395768
NCBI-ProteinID: NP_990259
CGNC: 4851
Ensembl: ENSGALG00000041154
UniProt: Q9YHY7
Position
2
AA seq 349 aa
MEKSKNFRIDALLAVDPPKAAAQSAPLALVTGGSGGGSPPSSSSSSSSSSSSSSELPADC
PRTDSPSPPRLLPAHCALLPKAAFLGGGGPGGGHPQHHALGLHPAGPGGPGLYGHPVYGY
PALGGQHPALSYSYSQVQGAHPAHPSADPIKLSAGTFQLDQWLRASTAGMILPKMPDFGS
QAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQN
RRMKWKRQKKAKEQAAQEAENEKGGGGGEDKSGPRELLLPGPEKGGGRRLRELPDSEPED
EEEEEEEEEEAEAGRCCPYHSSDCSEADEEDSQSGGRPGAPPPPPAQPQ
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggaaaaatccaaaaatttccgcatcgacgcgctgctggctgtcgatccccccaaggcg
gcggcgcagagcgctccgctggccctggtcaccggcggctccggcggcggcagccctccg
tcttcgtcgtcctcctcgtcgtcgtcgtcctcctcttcttccgagctccccgccgactgc
ccgcgcaccgacagcccctctccgcctcgcctgctgcccgcgcactgcgcgctgctgccc
aaagccgccttcctgggcggggggggacccgggggcggccacccgcagcaccacgccctg
gggctgcaccccgcggggccgggcgggccgggcctctacgggcacccggtgtacggctac
ccggcgttgggcgggcagcacccggcgctctcctattcctattcgcaagtgcagggagcg
caccccgcgcatccctccgccgaccccatcaagctgagcgccggcacctttcagctggac
cagtggctgcgggcgagcacggccggcatgatcctgcccaaaatgcccgacttcggctct
caggcgcagtccaacctgctggggaagtgccggcggccgcgcaccgccttcaccagccag
cagctgctggagctggagcaccagttcaaactcaacaagtacctctcccggcccaagcgc
ttcgaggtggccacgtcgctgatgctcaccgagacgcaggtgaagatttggttccagaac
cgccgcatgaaatggaagcgccagaaaaaggcgaaggagcaggcggcgcaggaggcagag
aacgagaaaggaggaggaggaggagaggacaaaagcgggccgagggaactgctgctgccc
ggcccggagaaaggcggcgggaggcggctgagggagctgcccgacagcgagcccgaggac
gaggaggaggaagaagaggaggaagaggaggccgaggccgggcggtgctgcccctaccac
tcctccgactgctccgaggcggacgaggaggactcgcagtccggaggacggcccggagcc
cccccgccaccccccgcacagccgcagtga

DBGET integrated database retrieval system