KEGG   Gallus gallus (chicken): 395770Help
Entry
395770            CDS       T01006                                 

Gene name
TRHR
Definition
(RefSeq) thyrotropin-releasing hormone receptor
  KO
K04282  thyrotropin-releasing hormone receptor
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    395770 (TRHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    395770 (TRHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    395770 (TRHR)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Peptide
   Thyrotropin-releasing hormone (TRH)
    395770 (TRHR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 395770
NCBI-ProteinID: NP_990261
CGNC: 49468
Ensembl: ENSGALG00000033701
UniProt: O93603
Position
2
AA seq 395 aa AA seqDB search
MENGTGDEQNHTGLLLSSQEFVTAEYQVVTILLVLLICGLGIVGNIMVVLVVLRTKHMRT
PTNCYLVSLAVADLMVLVAAGLPNITESLYKSWVYGYVGCLCITYLQYLGINASSFSITA
FTIERYIAICHPIKAQFLCTFSRAKKIIIFVWSFASVYCMLWFFLLDLNIAVYKDTTVVS
CGYKVSRSYYSPIYMMDFGIFYVLPMVLATVLYGLIARILFLNPIPSDPKENSNTWKNDM
AQQNKTVNSKMTNKSFNSTIASRRQVTKMLAVVVVLFAFLWMPYRTLVVVNSFLSSPFQE
NWFLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCHLKRDKKPANYSVALNYNVIK
ESDHFSSEIEDITVTNTYLSSAKTSIGDTCLSSEA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggagaatggcacaggcgacgagcagaaccatactgggctgctgctgtcaagccaggag
ttcgttacagctgaataccaagtggttaccatcctcttggtcctcctcatctgtggactg
ggcatcgtgggcaacatcatggtggtcttggtggtcctcagaaccaaacacatgagaact
cccactaactgctatctggttagtctggctgtggcagatctcatggtgcttgtggctgca
ggactacccaatatcacagaaagtctgtacaaatcctgggtctatggctatgtggggtgc
ctctgcatcacttatctccagtacctagggatcaatgcttcttctttttccatcactgct
ttcaccatcgagagatatatagctatctgccacccaatcaaagctcaattcctatgcaca
ttttcaagagctaagaagatcattatttttgtctggtctttcgcctcagtatactgtatg
ctctggtttttcctattagatctcaatatagcagtctacaaagacactacggttgtgtct
tgtggatacaaggtgtccaggagctattactctcctatctacatgatggacttcggaata
ttttatgttttgccaatggtattggcaactgtcctctatggcctgattgctagaatactg
ttcctgaatcccatcccttcggacccaaaagaaaactctaacacgtggaaaaatgacatg
gctcaacaaaacaagactgtgaattccaagatgactaacaagagtttcaatagcactatt
gcttctagaagacaggttaccaagatgttggctgtggtggtagtcctctttgcatttctg
tggatgccctatcgaacactggtggttgtcaattcctttctctccagtcccttccaagaa
aactggttcctgctattttgcagaatctgtatttatttaaatagtgccatcaatcctgta
atttacaatctcatgtcccagaaattcagagcagccttcaggaaactctgcaactgccat
ctaaaacgggacaagaaacctgccaattacagtgtggccctaaattataatgtcatcaaa
gagtctgatcacttcagcagtgaaatagaagatattactgtcaccaatacctatttgtcc
tctgcaaaaacatccattggtgacacatgtttgtcttctgaggcctga

DBGET integrated database retrieval system