KEGG   Gallus gallus (chicken): 395772
Entry
395772            CDS       T01006                                 

Gene name
KRT7
Definition
(RefSeq) keratin, type II cytoskeletal cochleal
  KO
K07605  type II keratin, basic
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    395772 (KRT7)
   04147 Exosome [BR:gga04147]
    395772 (KRT7)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     395772 (KRT7)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   395772 (KRT7)
  Exosomal proteins of other body fluids (saliva and urine)
   395772 (KRT7)
  Exosomal proteins of colorectal cancer cells
   395772 (KRT7)
  Exosomal proteins of bladder cancer cells
   395772 (KRT7)
SSDB
Motif
Pfam: Filament Keratin_2_head TPR_MLP1_2 Spc7 CENP-F_leu_zip ADIP CALCOCO1 DUF4407 FPP ATG16 Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 395772
NCBI-ProteinID: NP_990263
CGNC: 49470
Ensembl: ENSGALG00000034868
UniProt: O93532
Position
33
AA seq 492 aa
MSRSVSFSSRSVAVPGVSQVRVSSVSSVRGGGSLNKAGGFGSSSLYNLGSANKRISLGGS
SSYSVRSGYGYGGMGFGGAIAPSAGIQEVTVNQNLLTPLNLEIDPNIQRVRKEEKEQIKT
LNNRFASFIDKVRFLEQQNKMLETKWSLLQDQKTTRSNIVPMFEAYITNLRRQLDGLLND
KGRLEGELRNMQDLVEDFKAKYEDEINKRTTAENEFVVLKKDVDAAYMNKVELEAKVDAL
TDEINFLRSLYEAELRELQAQISDTSVVLSMDNSRNLDLDSIIAEVKAQYEDIANRSRAE
AESWYQSKFEALQVTAGKHGDDLRNTKNEITEINRVIQRLQGEIENAKAQRAKMEAAIAE
AEERGELAVKDARAKLEELEAALQKAKQDMARQLREYQELMNVKLALDIEIATYRKLLEG
EESRLAGDGVGSVNISMVSSSGGGSSGFLGGGVRGGLALGAGMGSGALGFSSGGSTKSYT
VTTTSSTRSFRK
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgtcccgctccgtcagcttcagctctcgctccgtggccgtcccaggggtcagccaggtg
cgggtcagctccgtctcctctgttcgtggaggtggtagccttaacaaggcggggggcttt
ggcagctccagcctctacaacctgggctctgccaacaagcggatctccctcggaggcagc
agctcctacagcgttcgctctggatacggctacggcggcatggggttcggaggggccatc
gcccccagtgcgggcatccaggaagtcaccgtcaaccagaacctcctgacccccctcaac
ctggagatcgaccccaacatccagcgggtgcgcaaggaggagaaggagcagatcaagacc
ctcaacaaccgctttgcttccttcatcgacaaggtccggttcctggagcaacaaaacaaa
atgctggagaccaaatggagtctgctccaggaccagaagaccacccggagtaacatcgtc
cccatgtttgaggcgtacatcaccaacctgaggcggcagctggacgggttgttaaatgac
aaagggcgtctggagggtgaactgaggaacatgcaggatcttgttgaggatttcaaggcc
aaatatgaagatgagatcaacaagcgcacgacagcagagaatgagttcgtggtgctcaag
aaggatgtggatgctgcctacatgaataaagtggagctggaggccaaggtggatgcactg
acggatgagattaacttcctgagatctctctacgaagcggagcttcgtgagctgcaggcc
cagatctctgacacctccgtggtgctgtccatggacaacagcagaaacctggacctggac
agcatcattgcagaggtcaaagcacagtatgaggatattgccaacaggagccgggcagag
gctgagtcctggtaccagagcaagttcgaagcactgcaggtcactgctgggaaacacggg
gacgatctgcgcaacaccaagaatgaaatcacagagataaaccgtgtgatccagaggctg
cagggtgaaattgaaaacgcaaaggcccagcgtgccaagatggaagctgccattgctgaa
gctgaggaacgtggtgagctggctgtcaaagacgccagggcaaagctggaggagctggaa
gctgctctgcaaaaggcaaagcaggacatggcccgacagctgcgtgagtaccaggagctg
atgaacgtcaagctggccctggacattgagattgcaacctacaggaagctgctggagggc
gaggagagcaggttggctggcgatggagttggcagcgtcaacatctccatggtctcctcc
agtggcggtggatccagtggattcctgggaggaggggtccgtggaggccttgccctggga
gcagggatgggcagtggagcgctcggcttctcctcggggggctccaccaaatcctacacc
gtcaccacaacctcatccaccagaagcttcaggaagtaa

DBGET integrated database retrieval system