KEGG   Gallus gallus (chicken): 395774
Entry
395774            CDS       T01006                                 

Gene name
GSN
Definition
(RefSeq) gelsolin precursor
  KO
K05768  gelsolin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    395774 (GSN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    395774 (GSN)
   04147 Exosome [BR:gga04147]
    395774 (GSN)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Gelsolin / villin
     395774 (GSN)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   395774 (GSN)
SSDB
Motif
Pfam: Gelsolin
Other DBs
NCBI-GeneID: 395774
NCBI-ProteinID: NP_990265
CGNC: 49472
Ensembl: ENSGALG00000001446
UniProt: O93510
Position
17
AA seq 778 aa
MGKQGFGYIFLTIFCTMALKLNCVSSVSVAGLGYVVTAAVVLSAVPVSMVEHAEFSKAGK
EPGLQIWRIEKFDLVPVPKNLYGDFFTGDSYLVLNTIRQRSGNLQYDLHFWLGDESSQDE
RGAAAIFTVQMDDYLQGKAVQHREVQGHESSTFLGYFKSGIKYKAGGVASGFRHVVPNEV
TVQRLLQVKGRRTVRATEVPVSWESFNTGDCFILDLGSNIYQWCGSNSNRQERLKATVLA
KGIRDNEKNGRAKVFVSEEGAEREEMLQVLGPKPSLPQGASDDTKTDTANRKLAKLYKVS
NGAGNMAVSLVADENPFSQAALNTEDCFILDHGTDGKIFVWKGRSANSDERKAALKTATD
FIDKMGYPKHTQVQVLPESGETPLFKQFFKNWRDKDQTEGLGEAYISGHVAKIEKVPFDA
ATLHTSRAMAAQHGMEDDGSGKKQIWRIEGSEKVPVDPATYGQFYGGDSYIILYDYRHAG
KQGQIIYTWQGAHSTQDEIATSAFLTVQLDEELGGSPVQKRVVQGKEPPHLMSMFGGKPL
IVYKGGTSREGGQTTPAQTRLFQVRSSTSGATRAVELDPAASQLNSNDAFVLKTPSAAYL
WVGRGSNSAELSGAQELLKVLGARPVQVSEGREPDNFWVALGGKAPYRTSPRLKDKKMDA
YPPRLFACSNKSGRFTIEEVPGDLTQDDLATDDVMILDTWDQVFVWIGKDAQEEEKTEAL
KSAKRYIETDPASRDKRTPVTLVKQGLEPPTFSGWFLGWDDDYWSVDPLQRAMADVDV
NT seq 2337 nt   +upstreamnt  +downstreamnt
atgggaaagcagggctttggttatatttttcttaccattttttgcacaatggctctgaag
ctgaactgtgtgagctccgtgtctgttgcagggcttggctatgttgttacagcagctgtg
gtgctttcagctgtgcctgtcagcatggtggagcacgctgagttttcgaaggctgggaag
gagcctggcctccagatttggaggatcgagaaatttgatttggtaccagtgccaaaaaat
ctgtacggagacttcttcacaggggattcctatctggtgctgaacaccatcaggcagcgg
agtgggaacctccagtacgacttgcacttctggttaggagatgaaagctctcaagatgag
cgtggggcagctgccatattcactgttcagatggatgactacctgcaagggaaagctgtc
cagcaccgtgaagtgcaaggccatgaatcctcaacgttcctggggtatttcaagtctggc
atcaagtacaaggctggtggcgtggcttctggcttcaggcatgtggttcccaatgaagta
actgtgcagaggcttctccaggtcaagggcaggagaacagtcagagcaacagaggtccct
gtgagctgggagagcttcaacacgggggattgtttcatccttgaccttggcagtaacatc
tatcagtggtgtggctccaacagcaaccgccaggagcgtctgaaggccactgtcctagcc
aaggggattcgggacaatgagaagaacggtcgtgccaaagtctttgtttcagaggaagga
gcagaacgggaggaaatgcttcaggtcctaggaccaaagcccagcttgccacaaggagct
tctgatgatactaaaactgatacagccaatagaaagctggctaagctctataaggtctca
aatggggctgggaacatggcagtttcccttgtggcagatgaaaaccccttctcccaggca
gcactgaacacggaagactgcttcattctggaccatggcacagatggaaagatctttgtt
tggaaaggcaggagtgccaattctgatgagagaaaggcagccctgaaaacagctactgat
ttcattgataagatgggttatccgaaacatacccaggtccaagttctccctgagagtggt
gaaacacctttgtttaaacaattcttcaagaactggagggacaaggaccagacagaagga
ctgggagaggcttacatttctggtcatgttgccaaaatcgagaaagtaccttttgatgct
gccactctacacacctccagggccatggctgcccagcatggcatggaggatgatggttct
ggcaagaaacagatttggagaatagaagggtcagagaaagtgccagtggatcctgcaaca
tatggccaattctatggaggggatagttatatcatcttgtatgactaccggcatgctgga
aagcaggggcagatcatttacacttggcagggtgctcattccactcaagatgaaattgcg
acttcggcattcctcacagtacagctggatgaggagctgggaggcagccctgtgcagaaa
cgagtagtgcaaggaaaagagccacctcatctgatgagcatgtttggaggaaaacccttg
attgtttacaagggtggaacatctcgggaaggaggccagaccacaccagcacaaacacgc
ctgttccaggtccggtccagcacctcgggagccaccagagctgtagagctggatcctgct
gcaagtcagctgaactccaatgatgcttttgtcctgaaaactccctctgctgcttacctc
tgggttggccgaggctccaacagtgccgagctgtcaggagcacaagaactgctgaaggtt
ctgggagctcgcccagtacaggtttccgagggtagagagccagataacttttgggtggct
ttgggtggaaaagctccctaccgtacctctcctcggctgaaggacaagaagatggatgct
tacccccctcgtctttttgcatgctccaacaagagtggacgcttcactattgaagaagtc
cctggagatctgactcaggatgaccttgcaacagatgatgttatgatccttgacacatgg
gatcaggtgtttgtatggattggaaaagatgcccaggaggaagaaaagactgaggctttg
aaatcagctaaacgatacattgaaactgatccagccagccgtgataagagaactccagtc
acactggttaagcaggggcttgagcctccaaccttctctggctggttcctgggctgggat
gatgactactggtctgttgatcctctgcagagagcaatggcagatgtggatgtctaa

DBGET integrated database retrieval system