KEGG   Gallus gallus (chicken): 395793
Entry
395793            CDS       T01006                                 

Gene name
TBX19
Definition
(RefSeq) T-box transcription factor TBX19
  KO
K10184  T-box protein 19
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395793 (TBX19)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Other transcription factors
   T-box
    395793 (TBX19)
SSDB
Motif
Pfam: T-box
Other DBs
NCBI-GeneID: 395793
NCBI-ProteinID: NP_990281
CGNC: 49480
Ensembl: ENSGALG00000015244
UniProt: P79778
Position
1
AA seq 397 aa
MADLGCKKPSDCTVSRLLSVVESELRAGRDKGDPTEKQLQVVLEDAPLWQRFREVTNEMI
VTKNGRRMFPVLKISVSGLDPNAMYSFLLDFAPTDGHRWKYVNGEWVPAGKPEPPNHSCV
YIHPDSPNFGAHWMKAAISFSKVKLTNKLNGSGQIMLNSLHKYEPQVHIVRVGGPHRMVM
NCSFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERNHPKDAPEAASEGQHMTYSH
SPQAPHGCERYSALRGHRAAPYPPSYMQRNHSPTVNFFESSSNNLQVFSGHDSWTLPSSP
HANLLSVPHTKGATSPGPSHYPCLWPVSNSAVSVTNPGSEVNSNTSSMFLRGNVPLPTAS
SSVQIPLQATVSGGMETQGEAPLVRLADSAWTSSHSF
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcagacctgggctgcaaaaagcccagtgactgcaccgtctccaggctgctcagcgtc
gtggagagcgaactccgggctgggagagacaaaggtgaccccactgagaagcagctccag
gttgtcttagaggatgctcccctttggcagagattcagagaagtcaccaacgagatgatt
gtgaccaagaatggcaggcggatgttccctgttttgaagatcagcgtctcaggcttggac
ccaaatgccatgtattctttcctgttagactttgccccgactgatggccaccgctggaag
tacgtcaatggagaatgggtgccagctgggaaaccagagccaccaaaccacagctgtgtc
tacatccacccagattctcccaactttggggcccactggatgaaagctgccatctccttc
agcaaagtcaaacttaccaacaagctcaatgggagtgggcagataatgttgaactccctg
cataaatacgagccccaggtacacatagttcgtgtaggaggcccccaccggatggtgatg
aactgttccttccctgagactcagttcatagctgtgactgcctatcaaaatgaggagata
acagctctcaaaatcaagtataatccctttgccaaagccttcctggatgcaaaagaaaga
aaccatcccaaggatgcaccagaagcagcctctgaaggtcaacatatgacatactctcac
tctccacaggctccccacggctgcgagcgatattcagcactgcgagggcatcgggctgct
ccatacccaccttcctacatgcaaagaaatcattcacctacagtgaatttttttgagagc
tccagcaataatcttcaggtattctcaggacatgacagctggactttgccatcctctcca
catgctaacttgctttcagtgccacacaccaagggagctaccagcccggggcccagtcat
tacccttgtctgtggccagtgagcaacagtgctgtaagtgtcaccaacccaggaagtgag
gtgaacagcaacacttcaagcatgtttctaaggggtaatgtacccttacctactgcgtct
tcatccgtccaaatccctctgcaggcaactgtgtctggtggcatggaaacacaaggggaa
gctcctctagtcagactagccgactctgcgtggacatcctcacactccttttaa

DBGET integrated database retrieval system