KEGG   Gallus gallus (chicken): 395794
Entry
395794            CDS       T01006                                 

Gene name
FOXD3
Definition
(RefSeq) forkhead box protein D3
  KO
K09397  forkhead box protein D
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395794 (FOXD3)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    395794 (FOXD3)
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 395794
NCBI-ProteinID: NP_990282
CGNC: 49481
Position
8
AA seq 396 aa
MTLSGGGSDMSGQTALAAEDVDIDVVGEGDDAPGKDGDGEARSPAALPRLPLDEAAEPGE
PGAGGESGSSGSGSPAPAGPEGGRGGGGGGGGGEEGASGGGAAAAAAAGQSKPKSSLVKP
PYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKI
PREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFKRHQQEHLRDQTALMMQGFGAYGLA
GPYGRPYGLPPGAYPHPAALQYPYIPPVGPMLPPAVPLLPSGELSRKAFNAQLGPSLQLQ
LSSLGAAGSIVKSEPSSRPSFSIENIIGGPAASSAPSAQTFLRPPVTVQSGLVAHQPLAL
ARTTAAIAPILSVPTNIIAGQFLQPPAAVQAKWPAQ
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgactctatcgggcggcggcagcgatatgtccggccagaccgcgctggcggccgaggac
gtggatatcgacgtggtgggcgagggagacgacgcgccgggcaaggacggggacggcgag
gcccgcagccccgccgcgctgccgcggctgccgctggacgaggcggcggagcccggcgag
ccgggagcgggcggcgagagcggcagcagcggcagcggcagcccggccccggcgggcccc
gagggcggcagagggggcggcggcggcggcggcggcggcgaggagggggcgagcggcggg
ggagcggcggcggcggcggcggcggggcagagcaagccgaagagcagcctggtgaagccg
ccctactcgtacatcgcgctcatcaccatggccatcctgcagagcccgcagaagaagctg
acgctcagcggcatctgcgagttcatcagcaaccgcttcccctactatcgggagaagttc
cccgcctggcagaacagcatccgccacaacctctcgctcaacgactgcttcgtgaagatc
ccccgcgagcccggcaacccgggcaagggcaactactggacgctggacccgcagtccgag
gacatgttcgacaacggcagcttcctgcggcggaggaagcgcttcaagcggcaccagcag
gagcacctgcgggaccagacggcgctcatgatgcagggcttcggcgcctacgggctggcc
gggccctacggccgcccctacgggctgccccccggcgcctacccgcaccccgccgctctg
cagtacccctacatcccgcccgtcgggcccatgctgccgcccgcggtgccgctgctgccg
tcgggcgagctgagccgcaaagccttcaacgcgcagctcgggcccagcctgcagctgcag
ctcagcagtttgggggcggcgggctccatcgtgaaatccgagcccagcagccgcccctcg
ttcagcatcgagaacatcatcggcggccccgccgccagctcggcgcccagcgcgcagact
ttcctgcggccgcccgtcaccgtgcagtcgggcctggtggcgcaccagccgctggcgtta
gccaggaccaccgcggccatcgcgcccatcctcagcgtgcctaccaacatcatcgcgggg
cagttcctgcagccccccgccgccgtgcaggccaagtggccggcgcagtga

DBGET integrated database retrieval system