KEGG   Gallus gallus (chicken): 395796
Entry
395796            CDS       T01006                                 

Gene name
RPS27A
Definition
(RefSeq) ubiquitin-40S ribosomal protein S27a
  KO
K02977  ubiquitin-small subunit ribosomal protein S27Ae
Organism
gga  Gallus gallus (chicken)
Pathway
gga03010  Ribosome
gga04120  Ubiquitin mediated proteolysis
gga04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    395796 (RPS27A)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    395796 (RPS27A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    395796 (RPS27A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gga03011]
    395796 (RPS27A)
   04121 Ubiquitin system [BR:gga04121]
    395796 (RPS27A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    395796 (RPS27A)
Ribosome [BR:gga03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    395796 (RPS27A)
  Archaea
    395796 (RPS27A)
Ubiquitin system [BR:gga04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   395796 (RPS27A)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   395796 (RPS27A)
  Exosomal proteins of colorectal cancer cells
   395796 (RPS27A)
SSDB
Motif
Pfam: ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD DUF2407 Ubiquitin_5 IBR
Other DBs
NCBI-GeneID: 395796
NCBI-ProteinID: NP_001274134
CGNC: 49483
Ensembl: ENSGALG00000036790
UniProt: P79781
Position
3
AA seq 156 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE
CPSEECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
NT seq 471 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaagacccttacggggaagaccatcaccctcgaggttgagccctcc
gatactatagaaaatgtgaaagctaagattcaggataaggaaggaattcctcctgatcag
cagcgactgatttttgctgggaagcagctggaagatggccgcacgctgtctgactacaat
atccagaaagaatcaactcttcaccttgtgctgagactgcgtggtggtgctaagaaaaga
aagaagaagtcttacaccacccccaagaagaacaagcataagaggaagaaggttaaactt
gccgtgctgaagtactacaaggtggatgagaacggcaagatcagtcgtctgcgccgagag
tgcccctctgaggagtgtggggcgggagtcttcatggctagccacttcgacagacactat
tgtggcaagtgttgtctgacatactgcttcaataagcctgaagacaagtaa

DBGET integrated database retrieval system