KEGG   Gallus gallus (chicken): 395798Help
Entry
395798            CDS       T01006                                 

Gene name
ACAN
Definition
(RefSeq) aggrecan core protein precursor
  KO
K06792  aggrecan 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:gga00535]
    395798 (ACAN)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    395798 (ACAN)
   04091 Lectins [BR:gga04091]
    395798 (ACAN)
Proteoglycans [BR:gga00535]
 Extracellular matrix (ECM) proteoglycans
  Aggrecan / versican family
   395798 (ACAN)
Glycosaminoglycan binding proteins [BR:gga00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   395798 (ACAN)
Lectins [BR:gga04091]
 C-Type lectins
  Group 1: Proteoglycan core proteins
   395798 (ACAN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xlink Lectin_C V-set Sushi EGF hEGF UL45 EGF_CA
Motif
Other DBs
NCBI-GeneID: 395798
NCBI-ProteinID: NP_990286
CGNC: 5079
Ensembl: ENSGALG00000006725
UniProt: P79787 F1NZX1
Position
10
AA seq 2089 aa AA seqDB search
MTTLLLVFVCLQAITTAASAELSDSSDGLEVKIPEQSPLRVVLGSSLNIPCYFNIPEEED
TNALLTPRIKWSKLSNGTEIVLLVATGGKIRLNAEYREVISLPNYPAIPTDATLEIKALR
SNHTGIYRCEVMYGIEDRQDTIEVLVKGVVFHYRAISTRYTLNFERAKQACIQNSAVIAT
PEQLQAAYEDGYEQCDAGWLADQTVRYPIHLPRERCYGDKDEFPGVRTYGVRETDETYDV
YCYAEQMQGKVFYATSPEKFTFQEAFDKCHSLGARLATTGELYLAWKDGMDMCSAGWLAD
RSVRYPISRARPNCGGNLVGVRTVYLNPANQTGYPHPSSRYDAICYSGDDFEALVPGLFT
DEVGTELGSAFTIQTVTQTEVELPLPRNVTEEEARGSIATLEPMEITATATELYEAFTVL
PDLFATSVTVETASPREENVTREEITGIWAVPEEVTTSVSGTAFTTGMAEVSSVEEAIAV
TATPGLESASPFTIEDHLVQVTAAPDVALLPRQPISPTGVVFHYRAATSRYAFSFIQAQQ
ACLENNAVIATPEQLQAAYEAGFDQCDAGWLRDQTVRYPIVNPRSNCVGDKESSPGVRSY
GMRPASETYDVYCYIDRLKGEVFFATQPEQFTFQEAQLYCESQNATLASAGQLHAAWKQG
LDRCYPGWLADGSLRYPIVSPRPACGGDAPGVRTIYQHHNQTGFPDPLSRHHAFCFRALP
SVVEEGVTSLFEEEVMVTQLIPGVEGIPSGEETTVETELSSEPENQTAQGTEVFPTDVSL
LSARPSAFPPATVIPEETSTNASIPEVSGEFPESGEHPTSGEPSASGAPDTSGEPTSVGF
ELSGEQSGIGESGLPSVDLQSSGFVPGESGLPSGDVSGLPSGIVDISGLPSAEEEVTVSV
SRIPEVSGMPSGAESSGLHSGFSGEISGTELISGLPSGEESGLASGFPTISLVDSTLVEV
VTAAPGRQEEGKGSIGVSGEEELSGFPSAEWDSSGARGLPSGAETSGEQSGVPELSGEHS
GVPGLSGEPFEVPELSGEHSGVTELSGEHSGLPELSGEPFGVPELSGFPSGLDISGEPSG
APEVSGPVDVSGLTSGVDGSGEVSGVTFISTSLQEVTTQSVAEAEAKEILEISGLPSGET
SGMVSGSLDVSGQPSGHIDFGGSASGVLEMSGFPSGAVESSGEASGVEVTSVLASGEESG
LTSGFPTVSLVDTTLVEVVTQTSVAQEVGEGPSGMIEISGFLSGDRGVSGEGSGAVQSSG
LPSGTGDFSGEPSGIPYFSGDISGATDLSGQPSAVTDISGEDSGLPEVTLVTSDLVEVVT
RPTVSQELGGETAVTFPYVFGPSGEGSASGDLSGGASAEGGIETSAAYEISGESSAFPET
SIETSTDQEISGEASAYPEISVETSTHLETSGETSAYPEISTETSTIQEVSGETSAFPEI
STETSTIQEISGETSAFPEIRIETSTFQEISGETSAFPEIRIETSTSQEARGETSAFPEI
TIEASTVHETSGETSAFPEISIETSTVHEISGESSAFPEIRIETSTSQEARGETSAFPEI
TIEASTIQEISGETSAFPEISIATSTVREISGETSAFPEIRIETSTSQEARGETSALPEI
TVETSTVHETSGEASAFPEISIETSTRQEARGEASAYPEVSIEASTTQEVSGESSAFPEI
SVETSTSQEARGETSAFPEIGIETSTAHEGSGETPGLPAVSTDTAATSLASGEPSGAPEK
ETPDTTSHLITGVSGETSVPDAVISTSAPDVELAQGPRNTEETQLEIEPSTPAASGQETE
TAAVLDNPHLPATATAALHPASQEAVDALGPTTEDTDECHSSPCLNGATCVDGIDSFKCL
CLPSYGGDLCEIDLANCEEGWIKFQGHCYRHFEERETWMDAESRCREHQAHLSSIITPEE
QEFVNSHAQDYQWIGLSDRAVENDFRWSDGHSLQFENWRPNQPDNFFSAGEDCVVMIWHE
QGEWNDVPCNYHLPFTCKKGTVACGDPPVVENARTFGRKKDRYEINSLVRYQCDHGYIQR
HVPTIRCQPNGHWEEPRISCTNPSSYQRRLYKRSPRSRLRPGVVHRPTH
NT seq 6270 nt NT seq  +upstreamnt  +downstreamnt
atgaccactctactactagtgtttgtgtgtttgcaagccatcaccacagctgcctccgca
gagctctcagacagtagcgatggcctggaagtgaagatacctgagcagtctcccctgcgt
gttgtcctgggaagctccctgaacatcccctgctatttcaacatcccagaggaagaggac
accaatgctctgctgaccccccggatcaaatggagcaagctttccaatggaacagagatt
gtcttactagtggccaccggtgggaagatccggctcaatgcagagtacagagaggtgatc
tccttgcccaattaccctgccatccccactgatgccaccttggaaatcaaggcgctgaga
tccaaccacactgggatttatcgctgtgaagtgatgtatgggattgaggacagacaagac
accatagaggtcctggtgaaaggcgtcgtgttccactacagagcaatctccacaaggtac
actttgaacttcgagagggcaaagcaggcctgtatccagaacagtgctgtcattgccacc
cctgagcagctgcaggctgcctacgaggatgggtacgagcagtgcgatgccggctggctg
gctgatcagactgtcaggtaccccatccatctgccccgggagcgctgctacggtgacaag
gatgagtttccaggagtgagaacctacggtgtccgtgagacagatgaaacctatgatgtt
tactgctatgcagagcaaatgcaaggcaaagtcttctacgccacctcccccgagaagttc
accttccaggaagcttttgacaaatgccacagcttgggagcccgcctggccaccacgggc
gagctgtacttggcctggaaggatggcatggacatgtgcagtgcgggctggctggctgac
cgcagcgttcgctaccccatttccagagcacggcccaattgtggagggaacctggtgggc
gtgcggaccgtttacctgaaccctgccaaccagacagggtaccctcaccccagctcacgc
tacgatgccatctgttacagtggtgatgacttcgaggctctggtcccagggctgttcact
gacgaggttgggactgagctgggcagtgcttttaccatacagaccgtcacacagactgag
gtggagctgcccctgccacgcaatgtcacagaagaggaggcccgtggcagcatcgctacc
ctggagcccatggagatcacagccaccgccactgagctgtatgaggccttcaccgtcctg
cctgacctctttgccaccagtgtcacagtagagacagcttccccaagggaagagaacgtg
accagagaggagatcacagggatatgggctgtgcctgaagaggtcactacatcggtctca
ggcactgctttcaccaccggaatggcagaggtgagctcagtggaagaggccatagcagtg
actgccacaccaggactggagtctgcctctccattcaccatagaagatcatctcgtgcaa
gtgacagcagcccctgatgttgccctcctccccaggcagcccatttcccccactggtgtg
gtgttccactaccgtgctgccaccagcagatacgccttctccttcatccaagcccagcag
gcctgcctggagaacaatgccgttattgccactcccgagcagctccaggctgcctacgag
gctggctttgatcagtgcgatgccggctggctgcgggaccagacggtcaggtatcccatt
gtgaatccccgcagcaactgtgtaggagacaaagagagctccccaggtgtgcggtcatac
ggcatgcgcccggcctcagagacctacgatgtgtactgttacatcgacaggctaaagggt
gaggtgttttttgccacccagccagagcagttcaccttccaagaagcccagctgtactgt
gaaagccaaaatgccacgctggcctctgctgggcaactccacgctgcctggaagcagggc
ctggataggtgctaccctgggtggctggccgacggcagcttgcggtaccccattgtgagc
ccccgacctgcctgcgggggggatgcacctggtgtgaggaccatctaccagcaccacaac
cagacgggctttcctgaccctctgtcacggcatcacgctttctgcttcagagctctgcca
tccgtagtggaggagggggtgacctcactctttgaagaagaggtgatggtaacccaactg
atccctggagtggaaggaataccttctggggaggaaacaactgtggagacagagctttcc
tctgagcctgagaatcagacagcccagggaacggaggtcttcccaactgacgtatcactg
ctctcagcgagaccatctgcttttcctccagctactgtaataccagaggaaacaagtacc
aatgcttccatccccgaagtgtccggagagttccctgagtctggagagcacccaaccagt
ggcgaaccttcagcatctggagccccagacacgagtggagaaccaacttccgtaggtttt
gaactgagtggagagcaatccgggattggagaaagtggattaccatctgtagacctgcag
agcagtggctttgtacctggagaaagtggccttccctcaggggatgtgagcgggttgcct
tctggcattgttgatatcagcggcttgccttctgcagaggaagaggtaacggtgtctgtt
tcgaggataccagaagttagtggaatgccatctggagctgaaagcagtggtctgcattct
ggatttagtggagaaatctctggcactgagcttatcagtggcctgccatctggagaggaa
agtgggctcgcctctggttttcccaccatctccctcgtggattccactttggtggaggtt
gtaacggcagcaccgggacggcaagaggagggaaaaggatcaattggagtcagtggtgaa
gaagagctgtcagggtttccgtctgcagagtgggacagcagtggggccagagggctgccc
tcgggagctgaaaccagtggggagcaatccggggtgcccgagctcagtggggagcattcc
ggggtgcctgggctcagtggagagccttttgaggtgcctgagctcagcggggagcattcc
ggggtgactgagctcagtggggagcattctgggcttcctgagctcagtggagagcctttt
ggggtgcctgagctcagcgggtttccctccggactggacatcagtggggaaccatctgga
gcacccgaggtgagcggcccggtggacgtgagcggccttacctctggtgttgatggaagt
ggtgaggtctcaggcgttacctttataagcaccagcctgcaagaagtgacaacccagtca
gttgcagaagcagaagcaaaagaaattctagagatcagtggactgccttcaggagagaca
tcaggcatggtgtctgggagcttagatgtcagcggtcagccttcgggacacatagacttt
ggtgggagcgcttctggagtgctggagatgagcggatttccaagcggagcggttgagagc
agtggagaagcctctggggttgaagtcaccagtgtcctcgcgtctggagaggaaagtggg
ctcacctcaggctttcccaccgtgtctctcgtggataccacgttggtagaagttgtaacg
cagacatcagttgctcaagaggtgggagaaggaccatctgggatgatagaaatcagtgga
tttctttctggagacagaggagtatctggagaagggtctggagctgtgcagtctagtggg
cttccttcaggaacaggagacttcagcggagagccatccgggatcccgtatttcagcgga
gacatttctggagccacagatctaagcggacaaccttccgcagtgactgatattagtggg
gaggactcgggacttccagaagtcactttagtcacatccgatttagtagaagttgtgaca
aggccaacagtttcacaggagctgggtggggaaacagctgtgacgtttccctatgtcttt
gggccaagtggtgagggctctgcatctggagacctgagtgggggagcatctgcagaaggt
ggtatagaaacatcagcagcttatgaaatcagtggtgagagctctgccttccctgaaacg
agtatagaaacatccacagatcaagaaatcagtggggaagcatctgcataccctgagatt
agcgtagaaacatccacgcatctggaaaccagtggggaaacatctgcataccctgagatt
agcacagagacgtccaccattcaggaagttagtggggaaacgtctgcctttcctgaaatt
agcacagaaacatccacaatacaagagatcagtggggaaacatccgcatttcctgaaatt
agaatagaaacatccacctttcaagaaatcagtggggaaacgtccgcatttcctgaaatt
agaatagaaacatccacgagtcaagaagcccgcggcgaaacgtctgcgtttcccgagatt
accatagaagcctccacagtccatgaaaccagtggagaaacatctgcctttcccgaaatt
agcatagaaacatccacagtccatgaaatcagtggggaaagttctgcctttcctgaaatt
agaatagaaacatccacgagtcaagaagcccggggtgaaacatctgcgttccctgagatt
accatagaagcctccaccattcaagagatcagtggagaaacatctgcatttcctgaaatt
agcatagcaacttccaccgtccgtgaaatcagcggcgaaacgtctgcctttcctgaaatt
agaatagaaacatccacgagtcaagaagcccggggtgaaacatctgcattgcctgagatt
accgtagagacatccactgtccatgaaaccagtggggaagcgtctgcctttcctgaaatt
agcatagaaacttccacaagacaagaagccaggggtgaagcatccgcctaccctgaggtt
agcatagaggcatccacaactcaagaagtaagtggggaaagttctgccttccctgaaatt
agcgtagagacatccacaagtcaggaagcccgcggtgaaacatctgcctttcctgagatt
ggcatagagacatccacagcccacgaaggcagtggggaaactcctgggctgcctgctgtt
agcactgacactgctgccacgtctctggccagtggtgagccctccggtgctcctgagaag
gaaactcccgacacaacatcacatctgatcacgggcgtttcaggggaaacctctgtccca
gatgctgtaatcagtaccagtgctccagatgttgaactagcgcagggacccagaaacact
gaagagactcagcttgaaatagagccctccactcctgcggcatctggacaagagacagaa
acagctgctgtcctcgacaatccccatctgccagccactgctactgctgccctgcatcca
gcctcccaagaagcagtagatgcactgggacccacgacagaagacactgatgagtgccac
tcaagcccctgtctgaatggagctacctgcgttgatggcatcgactctttcaaatgctta
tgccttcccagctacggaggggacctgtgtgagatcgacctggcaaactgtgaggaaggc
tggatcaagttccagggccactgctacaggcactttgaagagagggagacgtggatggac
gcagagtccaggtgcagagaacatcaagcccacctgagcagcatcattactccagaggaa
caagaatttgtgaacagccatgcacaagactatcagtggatcggcctcagtgacagagcc
gtggagaatgatttccgctggtctgatggacactcgctgcaatttgagaactggcggccc
aaccaacctgacaacttcttctccgcgggcgaggactgcgttgtgatgatctggcatgag
caaggcgaatggaacgacgtcccctgcaactatcacctgcctttcacgtgcaagaaggga
acagttgcctgtggggacccacctgtagtggagaacgcgcggacctttggccggaagaag
gaccgctatgagatcaactccctggtgcggtaccagtgtgaccacggctacatccagcgc
cacgtgcccaccatccgctgccaacccaacgggcactgggaggaaccgcggatatcctgc
acaaacccctccagctaccaacgccggctatacaagaggagcccccggagccggttgaga
cccggtgtcgtgcacagacccacccattag

DBGET integrated database retrieval system