KEGG   Gallus gallus (chicken): 395802Help
Entry
395802            CDS       T01006                                 

Gene name
PROX1
Definition
(RefSeq) prospero homeobox protein 1
  KO
K20211  prospero homeobox 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395802 (PROX1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain with Prospero motifs
    395802 (PROX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HPD NifQ Nop25
Motif
Other DBs
NCBI-GeneID: 395802
NCBI-ProteinID: NP_001005616
CGNC: 7438
Ensembl: ENSGALG00000009791
UniProt: Q91018
Position
3
AA seq 736 aa AA seqDB search
MPDHDSTALLSRQTKRRRVDIGVKRTVGTASAFFAKARATFFSAMNPQGSEQDVEYSVVQ
HADGEKPNVLRKLLKRANSYEDAMMPFPGATIISQLLKNNMNKNGGTEPSFQASGLSSTG
SEVHQEDVCSNSSRDSPQECLSPFGRPTMSQFDVDRLCDEHLRAKRARVENIIRGMSHSP
RVALRGNENEREIRPQSVSPRESYRENKRKQNWPQQQQQSFQQLVSARKEQKREERRQLK
QQLEDMQKQLRQLQEEFYQIYDSTDSENDEDGNLSEDRMRSETVDAQAGDSVGRSDNEMC
ELDPGQFIDRARALIREQEIGENKPKREGPKEKDQGPNSFHPEGKHLAETLKQELNTAMS
QVVDTVVKVFSSKPSRQLPQVFPPLQIPQARFAVNGENHNFHTANQRLQCFGDVIIPNPL
DTFSSVPMPGATDQTDALPLVVRKNSSDQPASAPPAGGHHASLHQSPLSATAGFSTSSFR
HPFPLPLMAYPFQSPLGAPSASFPGKERASPESLDLTRETTSLRTKMSSHHMNHHPCSPA
HPPSAAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSN
MLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCEL
YRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEV
PEIFKSPNCLQELLHE
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaccatgacagcacagccctcttaagcaggcaaaccaagagaagaagagttgac
attggagtgaaaaggacggtagggacagcatctgcattttttgcaaaggcaagagcgacg
ttttttagtgccatgaatccccaaggttcagagcaggatgttgagtattcagtggtgcag
catgcagatggggaaaagccaaatgtactccgcaagctgctgaagagggcgaactcgtat
gaagatgccatgatgccttttccaggagcaaccataatttcccagctgttgaaaaataac
atgaacaaaaatggtggcaccgagcccagtttccaagccagcggtctctctagtacaggc
tcagaagtacatcaggaggatgtatgcagcaactcttcaagagacagcccccaagagtgt
ctttccccttttggcaggccgactatgagccagtttgatgtggatcggttatgcgatgag
cacctgagagctaaacgcgcccgagttgagaatatcattcggggtatgagccattccccc
agggtggcattaaggggcaatgaaaatgaaagagaaatacgtccgcagtccgtcagccct
cgagaaagttaccgagaaaacaagcgcaagcagaactggccgcagcagcagcagcagagc
ttccagcagctggtttcggccaggaaggagcagaagcgagaggagcgccgacagctgaag
cagcagctggaggacatgcagaagcagctgcgccagctgcaggaggagttctaccagatc
tacgacagcaccgactctgaaaatgatgaagatggcaacctgtctgaagacaggatgcgc
tccgagaccgtggatgcccaggctggtgactccgtcggcaggtcagacaacgagatgtgc
gagctggacccagggcagttcatcgaccgggcgcgggctctcatacgggagcaggagatc
ggggagaacaagccgaaaagagaaggtcccaaggagaaggaccaagggccaaattccttc
catcctgaaggtaaacacttggctgagacgctgaagcaggaactgaacactgccatgtca
caagttgtggacacagtggtgaaagttttctcgtccaagccctcccgccagcttccccag
gtcttcccacctctccagatcccccaggccaggtttgctgtcaatggggagaaccacaac
ttccacacggccaaccagcgcctgcagtgctttggggacgtcatcattccaaaccccctc
gacaccttcagcagcgtccccatgcctggtgccactgaccagactgacgcgctgcccctc
gtcgtccgcaagaactcctccgaccagcccgcctcggcccctccagccggtggccaccac
gcctcactgcaccagtccccactctcggccactgccggcttctccacctcctccttccgc
caccccttcccgctgcccctcatggcctaccccttccagagccctctgggcgccccgtca
gcctccttcccggggaaagagcgtgcctcccctgagtccctggacttgacccgggagacc
accagcctgaggaccaagatgtcgtcgcaccacatgaaccaccatccctgctcacctgca
cacccccccagtgctgccgaaggcctctccttgtccctcataaagtctgagtgtggtgac
ctgcaagacatgtctgaaatctcgccctactcgggaagtgcaatgcaggaaggcttgtcg
ccgaaccacttgaaaaaggccaagctcatgttcttttacacccggtacccaagttccaat
atgctgaaaacctacttctcagatgtaaagttcaacagatgcattacctctcagctcatc
aagtggtttagcaatttccgtgagttttactacattcagatggagaagtatgcgcggcaa
gccatcaacgacggggtcacgagcacggaggagctgtctataaccagagactgtgagctg
tacagggccctgaacatgcactacaataaagcgaatgactttgaggttccagagagattc
ctggaagtggctcagatcacgttacgggagtttttcaatgccattatcgcaggcaaagat
gttgatccttcctggaagaaggccatatacaaggtcatctgtaagctggacagtgaggtc
cctgagattttcaaatcccccaactgcctacaagagcttcttcatgagtag

DBGET integrated database retrieval system