KEGG   Gallus gallus (chicken): 395804
Entry
395804            CDS       T01006                                 

Gene name
PSMC1
Definition
(RefSeq) 26S proteasome regulatory subunit 4
  KO
K03062  26S proteasome regulatory subunit T2
Organism
gga  Gallus gallus (chicken)
Pathway
gga03050  Proteasome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    395804 (PSMC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:gga03051]
    395804 (PSMC1)
Proteasome [BR:gga03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     395804 (PSMC1)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_2 AAA_22 AAA_5 AAA_16 RuvB_N DUF815 AAA_18 AAA_25 ATPase IstB_IS21 AAA_3 AAA_14 AAA_33 AAA_28 RNA_helicase Mg_chelatase TIP49 Prot_ATP_OB_N PhoH AAA_7 AAA_24 NB-ARC AAA_30 NACHT ABC_tran Parvo_NS1 TsaE Sigma54_activat
Other DBs
NCBI-GeneID: 395804
NCBI-ProteinID: NP_990289
CGNC: 8111
Ensembl: ENSGALG00000010675
UniProt: Q90732
Position
5
AA seq 440 aa
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKPPLVTPHTQCRL
KLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNH
AIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKLEKAP
QETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA
NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHGPSIVFIDEIDAIGTKRYDSNSG
GEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKT
KKRIFQIHTSRMTLADDVTLDELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFK
KSKENFLYKKTEGTPEGLYL
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgggtcaaagtcagagcggcggccacgggcctggcggcggcaagaaggacgacaaggac
aagaagaagaaatatgaacctccggttccaaccagagtggggaagaagaagaagaagacg
aagggaccagatgctgccagcaagccgcccctggtgactcctcacacacagtgcagactc
aaactgctgaaattagagagaattaaagattacctgctaatggaggaagaatttatcaga
aatcaagaacaaatgaaacctttggaagaaaaacaagaggaggaaagatcaaaggtggac
gatctgaggggaacgccgatgtctgtgggtacattggaggagatcattgatgacaaccat
gccatcgtgtccacgtcagtgggatcagaacactacgtcagtattctgtcttttgtggac
aaggatttgctagagccaggctgctctgttttgctaaatcataaggttcatgctgtgatt
ggagtcctgatggatgacacagatcctttagttacagtgatgaagttagagaaggctccc
caagaaacgtatgctgacattggtggccttgacaaccagattcaggaaatcaaggagtct
gtggagcttcccctcacccaccctgagtactatgaagagatgggtataaagccacccaaa
ggagtcattctgtacggcccccctggcacaggtaaaactttactggccaaagcagtagca
aaccaaacatcggcaaccttcctgagagttgttggttcggagctcatccagaagtatttg
ggcgacggcccaaagctggtgagggaactgttccgtgtggctgaagagcacggcccgtcc
attgtcttcattgatgagatcgatgccattggtacaaagaggtacgactcaaattctggg
ggtgagagggagatccagcgtacaatgctggagctgctgaaccagctggatgggttcgac
tctcgtggggacgttaaagtcatcatggccacaaacagaatagaaactctggatccagct
ttaattaggccaggacgtatcgacaggaaaatagagttcccgctgcctgatgagaaaacc
aagaaacgaatcttccagattcacaccagcaggatgacattggcagatgatgtgactttg
gatgagctgattatggcaaaagatgatctcagcggtgcagatattaaggcaatttgtaca
gaagctgggttgatggctttgagggaacggcgaatgaaagtaacaaatgaagacttcaaa
aagtctaaagagaactttctctataagaagacggagggaaccccagagggattgtatctt
taa

DBGET integrated database retrieval system