KEGG   Gallus gallus (chicken): 395822
Entry
395822            CDS       T01006                                 

Gene name
NEO1
Definition
(RefSeq) neogenin isoform X1
  KO
K06766  neogenin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04350  TGF-beta signaling pathway
gga04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    395822 (NEO1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    395822 (NEO1)
SSDB
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 Ig_2 ig Pur_ac_phosph_N V-set Interfer-bind C2-set_2 Ig_5 Tissue_fac EphA2_TM Izumo-Ig TMEM154 Herpes_UL74 Ly49 Shisa
Other DBs
NCBI-GeneID: 395822
NCBI-ProteinID: XP_015134533
CGNC: 49497
Ensembl: ENSGALG00000001774
Position
10
AA seq 1472 aa
MAAGRARRLLGSLWLALLLGQPQPSAAAARSGPRSPLTGSVVRTFTPFYFLVEPMDILSV
RGASVIMNCSSYCETPPKIEWKKDGTLLNLVSDDRRQLLPDGSLLINSVVHSKHNKPDEG
YYQCVATVESLGSIVSRTAKLTVAGLPRFTSQPELSSVYKGNSAILNCEVNVDLAPFVRW
EQDRQPLSLDDRVFKLPSGALLIGNATDTDGGFYRCVIESGGTPKYSEEAELKILPDPEE
PQSLVFVRQPSSLTKVTGQNAVFPCVAGGFPTPYVRWTKNGEELITEDSERFALRAGGSL
LISDVTEEDVGTYTCIADNENETIEAQAELAVQVPPEFLKRPANIYAHESMDIVFECEVT
GKPTPTVKWVKNGDVVIPSDYFKIVKEHNLQVLGLVKSDEGFYQCIAENDVGNAQAGAQL
IILDLDVAIPTLPPTSLTSATNDHLAPATTGPLPTAPRDVVATLVSTRFIRLTWRTPVSD
PQGDNLTYSIFYTKEGINRERVENTSRPGETQVMIQNLMPETVYVFRVVAQNKHGHGESS
APLKVATQPEVQLPGPAPNIRAYAGSPTSVTVMWETPLSGNGEIQNYKLYYMEKGQDSEQ
DVDVAGLSYTITGLKKYTEYSFRVVAYNKHGPGVSTQDVVVRTLSDVPSAAPQNLTLEAR
NSKSIMLHWQPPPAGTHSGQITGYKIRYRKVSRKSDVTESVGGTQLFQLIEGLERGTEYN
FRIAAMTVNGTGPATDWVSAETFESDLDESRVPEVPSSLHVRPLVTSIVVSWTPPENQNI
VVRGYAIGYGIGSPHAQTIKVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAV
TRPHSDTSEVDLFVINAPYTPVPDPSPMMPPVGVQASILSHDTIRITWADNSLPKNQKIT
DARYYTVRWKTNIPANTKYKTANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAH
GTTFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWV
IEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPKAESSDKMPNDQAS
GSAGKGSRPVDVGPDYKPPLSGSNSPHGSPTSPLDSNMLLVIIVSVGVITIVIVVIVAVF
CTRRTTSHQKKKRAACKSVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIMT
DTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGRRGMRPKMMMPFDSQPP
QPVISAHPIHSLDNPHHHFHSGSLASPTRSYLHHQVSPWPVGTSMSHSDRANSTESVRNT
PSSDTMPASSSQPCADHQDPDSSSGAYLGSAQEEDAAQSLPTAHVRPSHPLKSFAVPAVP
AAGSAYDPTLPSTPLLTQQAPSHPVHSVKTASIGTLGRTRPPMPVVVPSAPDVQETTRML
EDSESSYEPDELTKEMAHLEGLMKDLNAITTA
NT seq 4419 nt   +upstreamnt  +downstreamnt
atggcggcggggcgagcgcggcggctgctcggctccctctggctggcgctgctcctcggg
cagccgcagccctcggccgccgccgcgcggagcggcccccggagccccctcacagggtcc
gtagtgagaaccttcactcctttttacttcctggtggagccgatggacattctgtcagtt
cgtggggcatctgttataatgaactgctcatcttattgtgaaactcctccgaagatcgaa
tggaagaaagatgggactcttctaaacttggtctcagatgaccgtcgccagttgctgcca
gatgggtctttattaataaacagcgtggtgcattccaagcataataaacccgatgaagga
tattatcagtgcgtggcaactgtggaaagcctggggagcattgtaagcagaacagcaaag
ctcacggtggcaggtcttcccaggttcaccagccagccggagctatcgtctgtctataaa
ggaaacagtgcaatcctgaactgcgaagtgaacgttgacctcgcgccgtttgtgaggtgg
gagcaggaccggcagcccctctccctggatgaccgtgtctttaagctgccgagcggagcg
cttcttattggtaacgctaccgatacagatggaggattctatcgctgcgtcattgaaagt
ggtgggacccccaaatacagtgaggaggcagagctcaaaattcttccagatccagaagag
ccccagagcttggtcttcgtgaggcagccatcttcacttactaaagttactgggcaaaat
gcggtttttccatgtgttgctggaggatttccaactccgtatgtcagatggacaaaaaat
ggagaagagctaatcacagaagactccgagaggtttgcgctgcgtgcggggggcagcctg
ctcatcagtgatgttacggaagaggacgttgggacgtacacctgcatagcagataacgag
aacgagacgattgaagctcaggcagagcttgcagtacaagttcctcctgagtttctgaag
cgacccgcaaacatttatgctcatgaatctatggacattgtcttcgagtgtgaagtgact
ggaaaacctactccaactgtgaaatgggtcaagaatggagacgtggtgattccaagcgac
tacttcaaaatcgttaaagaacataatctgcaagttttgggtctggtgaaatcagatgaa
ggattctatcagtgcattgcagaaaatgatgttggaaatgcacaggctggagcccagctg
ataatacttgacctcgatgttgccatcccaacattacctcccacttcactgaccagtgcc
actaatgaccatctagcaccagctacaacgggaccactgcctacagcccctcgggacgtc
gtggccaccctcgtctccactcgcttcatcaggctgacgtggcggacaccggtgtcagac
ccgcagggagacaacctcacctattcaatcttctacactaaggaaggtatcaacagggaa
cgtgttgaaaacaccagtcgtcctggagagacacaagtgatgatccaaaacctgatgcca
gaaacagtttatgtcttcagagttgtggctcagaacaagcacggccatggagagagctca
gcaccactgaaggtggccacgcagcctgaggttcagctgcctggtccagcacccaatatc
cgagcgtacgccggctcccccacctctgtcaccgtcatgtgggaaacaccactgtctggc
aatggggaaatccagaactacaagctctactacatggagaaggggcaggacagtgagcag
gatgttgatgtagcaggactctcctacaccattactggattaaagaagtacactgagtat
agtttccgagtggtggcttacaataaacacggccctggcgtctctacccaagatgttgtt
gtgcggacgctgtcagatgttcccagtgctgcaccacagaatctaacgctggaggcacgg
aattccaagagcatcatgctgcactggcagcctcctcctgcagggacacacagcggtcaa
atcaccggctacaaaatccgctaccgcaaagtgtcccgtaagagtgatgtgaccgagagc
gtcggggggacacagcttttccagctcattgaaggtcttgaacggggcacggagtacaac
ttccggatagctgccatgactgtgaatggcactgggccagctactgactgggtgtcagca
gaaacatttgagagcgatctggatgaaagccgtgttcctgaagttccgagctccttacac
gtccgtcctcttgtcaccagtattgtggtgagctggactccacctgagaaccagaacatc
gtggtgagaggctatgccatagggtatggcatcggcagtcctcacgcgcagaccatcaag
gtggactacaaacagagatactacaccattgaaaacttagacccgagctcgcactacgtt
ataactctgaaagcattcaacaatgttggtgaaggaattcctctctatgagagcgcagtg
accaggcctcattcagacacttccgaagttgatttgtttgttattaatgctccatacact
ccagtgccagatccatctcccatgatgccaccggtgggagttcaggcttccatcctgagc
catgacaccatacggatcacttgggcagacaactctctgccaaagaaccagaagatcacg
gatgctcgctactacacagttcgctggaaaaccaatattcctgcaaatacaaagtacaag
acggccaacgcgaccacgctgagctatttagtgactgggttaaaaccaaacacgttgtat
gaattctccgtgatggtgactaaagggcgaagatcgagcacgtggagcatgacagcacat
gggacaacttttgagctagttcctacttcacctcccaaggatgtgactgtggtgagcaaa
gagggaaagcctcggaccatcattgtgaactggcagcctccgtccgaagccaacggcaaa
attacaggatacatcatttactacagtacggacgtgaatgctgaaatacacgactgggtt
attgagcccgttgtggggaacaggctgacccaccagatacaagagctgaccctcgacacg
ccgtactacttcaaaattcaggcccgcaactcaaagggcatggggcccatgtctgaggcc
gtccagttcaggacccctaaagctgagtcctcagataaaatgcctaatgatcaagcttcg
ggatctgcagggaaaggaagccgcccagtggacgtggggccggactacaaacccccgctc
agcggcagtaacagtccccatggaagtccgacttctcccttggatagcaacatgcttctt
gtcatcatagtgtctgttggggtcatcaccattgtgatagtggtgatcgtcgccgttttc
tgcactcgtcgtaccacttctcaccaaaaaaagaaacgagctgcctgcaaatcagtgaac
ggctcccacaagtacaaagggaattccaaagatgtcaagcctcctgacctttggatccat
catgaaagactggagctaaagcccattgataaatctccagatcccaatccaatcatgaca
gataccccaatccctcgcaactcccaggacatcaccccagttgataattccatggacagc
aatattcaccaaaggcggaactcctacagagggcatgagtcggaggacagcatgtccacg
ctggcaggaagaagggggatgaggcccaagatgatgatgccttttgattctcagccgcct
cagcctgtgattagtgcccatcccatccattcactcgataacccccaccatcatttccac
tccggcagcctcgcttctccaactcgcagctatctccatcaccaggtcagcccgtggcca
gtgggcacatccatgtcccattcagacagggccaattccacagaatccgttcggaacaca
ccgagctctgacaccatgccggcctcctcgtcccagccgtgtgcggaccaccaggacccc
gacagcagctcaggcgcttacctgggcagtgctcaggaggaggacgcggcccagagcctg
cccacagctcacgtgcgtccatcccaccccctgaagagctttgcagtgccagcagtgcca
gcagccggctctgcctatgaccccacgctgcccagcaccccgctgctgacccagcaagct
ccctcccatccagttcactcggtgaagactgcatcgattgggactttaggaagaacacgg
cctcccatgcctgtggtggttcccagcgcccctgacgtgcaggagaccaccaggatgctc
gaggactcggaaagcagctatgaaccagatgagctgaccaaagagatggcccacctggaa
ggactgatgaaggaccttaatgccatcactacagcatga

DBGET integrated database retrieval system