KEGG   Gallus gallus (chicken): 395825
Entry
395825            CDS       T01006                                 

Gene name
SEMA3A
Definition
(RefSeq) semaphorin-3A
  KO
K06840  semaphorin 3
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Sema ig V-set PSI Ig_3 Ig_2 I-set Ig_6
Other DBs
NCBI-GeneID: 395825
NCBI-ProteinID: NP_990308
CGNC: 4946
Ensembl: ENSGALG00000006560
UniProt: Q90607
Position
1
AA seq 808 aa
MGRRCYLCCLKFPGGARQDGERRGSGSQGPYSGCCSMGWLRGIALLSLGVLLAGRVNCQH
VKNNVPRLKLSYKEMLESNNIVNFNGLANSSSYHTFLLDEERSRLYVGAKDHIFSFNLVN
IKEYQKIVWPVSHSRRDECKWAGKDILRECANFIKVLKTYNQTHLYACGTGAFHPMCTYI
EVGSHPEDNIFRMEDSHFENGRGKSPYDPKLLTASLLVDGELYSGTAADFMGRDFAIFRT
LGHHHPIRTEQHDSRWLNDPRFISAHLIPESDNPEDDKIYFFFRENAIDGEHTGKATHAR
IGQICKNDFGGHRSLVNKWTTFLKARLICSVPGPNGIDTHFDELQDVFLMNSKDPKNPIV
YGVFTTSSNIFKGSAVCMYSMTDVRRVFLGPYAHRDGPNYQWVPYQGRVPYPRPGTCPSK
TFGGFDSTKDLPDEVITFARSHPAMYNPVFPINSRPIMIKTDVDYQFTQIVVDRVDAEDG
QYDVMFIGTDIGTVLKVVSIPKETWHELEEVLLEEMTVFREPTVISAMKISTKQQQLYIG
SATGVSQLPLHRCDVYGKACAECCLARDPYCAWDGSSCSRYFPTAKRRTRRQDIRNGDPL
THCSDLQHHDNPSGQTLEEKIIYGVENSSTFLECSPKSQRAIVYWQFQKQNDDHKVEIKV
DDRMIRTEQGLLLRSLQRRDSGIYFCHAVEHGFIQTLLKVTLEVIDTDHLEELLHKEEDA
DASKTKDATNSMTPSQKIWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPANAQVN
TNKWKHLQENKKGRNRRTHEFERAPRSV
NT seq 2427 nt   +upstreamnt  +downstreamnt
atgggcagaagatgttatttatgttgcctgaagttccccggcggcgcccggcaggacggg
gagcgccgcggctccggctcgcagggaccctacagtggctgctgcagcatgggctggctc
agggggattgccttgctttccttgggagtattactagcaggaagagtgaactgccagcat
gtgaagaataacgtgccaagactcaaattatcctataaagaaatgttggaatccaataat
atagtcaatttcaatggactagctaatagttccagttaccatactttcctcttggatgaa
gaacgaagtcggctgtatgttggagcaaaagaccacatattttctttcaacctggttaac
atcaaggaatatcaaaagattgtttggcctgtatctcattcccgaagggatgagtgtaag
tgggctggaaaagatattctgagagaatgtgctaatttcatcaaggtgcttaagacttat
aaccaaacacacttgtacgcttgtggaacgggggcttttcatcccatgtgcacttatatt
gaagttggaagccatcctgaggacaacatttttaggatggaagattcacattttgaaaac
ggccgagggaaaagcccttacgatcctaaattgctgacagcttctcttttagtagatgga
gaattgtactctggcacagcagcagacttcatgggcagagactttgccattttccgaact
ctggggcatcaccatccaatcagaacagagcagcatgactcccggtggctaaacgatccc
agatttattagtgctcacctgatacctgaaagtgataatccagaagatgacaaaatctat
ttcttctttcgtgaaaatgcgattgatggagagcacactggaaaagccactcatgccaga
atagggcagatctgtaagaatgactttggtggacacaggagccttgttaacaaatggaca
actttcctcaaagcacgtctgatttgttctgtgccaggacccaatggtattgacacacac
tttgatgaattacaggacgtgttcctaatgaactctaaggaccctaaaaatccaatagtg
tatggagtgtttacaacttccagtaatatcttcaagggatcagcagtatgtatgtacagc
atgactgatgtgaggagggtatttcttggcccctatgcccaccgagatggcccaaactac
cagtgggttccctaccaagggcgagttccatatccacggccaggaacttgccccagtaaa
acatttggcggctttgactccaccaaggaccttcctgatgaagttataacatttgcaaga
agtcatcctgccatgtataacccagtattccccatcaacagccgtccaatcatgatcaaa
acggatgtagattaccagttcacacagatagtagtagatcgagtagatgcagaagatggt
caatacgatgttatgttcattggcacagatattggaacagttcttaaagtggtttccatt
cctaaggagacttggcatgaattagaagaagtcttgctggaagaaatgaccgtctttcgg
gaacccactgttatttcagcaatgaagatttccacaaaacagcaacagctctacattggc
tcagccaccggagtttcacagcttcctttacaccgctgtgatgtctatggaaaagcatgt
gctgagtgttgtcttgcaagagacccctactgcgcctgggatggttcatcttgctcacgt
tactttcccactgctaagagacgtactaggcgacaagacatccgaaatggagatcccctc
actcactgctcagacctgcagcatcatgataacccaagtggtcagaccctggaggaaaag
attatttatggagtagagaatagcagcacttttcttgagtgcagtccaaaatctcaacgt
gccatagtctactggcaattccagaagcaaaatgatgaccacaaagttgagataaaagtg
gatgatcgaatgatccggacagaacagggcctattgctacgaagtcttcaacggagagac
tctggtatttatttttgtcatgctgtggagcatggcttcattcaaactttgctcaaagtg
acactggaagtaattgatactgaccacttggaagagctgctccataaggaagaagacgcc
gatgcctccaagaccaaggatgctaccaatagcatgactcctagtcaaaagatctggtat
agagacttcatgcagttaatcaatcaccccaatctcaacacaatggatgaattctgtgag
caggtttggaaaagagaccgcaagcagcgccggcaaaggcctgccaatgcgcaggtgaac
acaaataagtggaagcacctacaagagaataaaaaaggtaggaataggaggacccatgaa
tttgagagggcaccacggagtgtctga

DBGET integrated database retrieval system