KEGG   Gallus gallus (chicken): 395828Help
Entry
395828            CDS       T01006                                 

Gene name
CHRD
Definition
(RefSeq) chordin precursor
  KO
K04657  chordin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    395828 (CHRD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHRD VWC
Motif
Other DBs
NCBI-GeneID: 395828
NCBI-ProteinID: NP_990311
CGNC: 20229
Ensembl: ENSGALG00000026983
Position
9
AA seq 942 aa AA seqDB search
MRTALLLLALLALPVRTARPKLALPIRPDSEPLPPGGAAGCAFGGRFYALEETWHPDLGE
PFGVMRCVICHCETQRNRRGKPVGKVNCKNMKQDCPVPTCPRATLLPGHCCHTCPKALPG
APEKSYKPPFDTFEYFQDKEDELDKPYNDRSYLSSEGSARDDARTEFVALLTSGPEPWHP
TSSAVAKARFTLLRSYLLFSISYERLGRPSRVRFSDPEGTVLFEHPVQKSAAPEDGMLCG
MWRTVSKANIQLLRAEQLRVSLITRAQPSGEVHGHILKHRALFAETFGAILTSSDPAHLG
AGGMAMLTLSDTENNLHFILMARGLLEPGAEESPWVPLRVRILHQGQTLREAHANITMED
PDFAEVLSDLSAHELQWLAQGQLRIVADTQGRHPRQLEGTITARRSCDTIQSVLCGADAL
QPTKTGAVGSAKLALHENGTLEYQVRVVGTASEVVGVTLETKPRRKNRRNVLFDMTPSYR
AGMAQGVWHSPSARDVHMLLQNELFLNVATKDWAEGELRGQVISLPYSGLLARYTEMPVP
LAGQLVSPPVSSGAGGHAWLSLDEHCHLHYEIVVAGLGRPADGTVSAQLHGVAELGEMGT
RPHLHKRMLKGFYGTEAQGVVKDLDAELLQHLAQGTAFLQVSTKAHPRGEMRGWVHIPNR
CQPGGARLSTGEAELSEGPKGRNVEQLKKDPNSCFFEGQHHAHGTRWAPDYDKKCSICSC
QKRTVICDPILCQPLNCTRQVHPEELCCPICEEKKMEQEELKLERARDSSEGCYFDGDKT
WRGSGTRWHPVVPPFGLIKCAICTCKGTTGEVHCEKVQCPRLTCANPVRVSPSDCCKQCP
APEKSIPELTDGMQADGPRACRFGRRWYLNNESWHPSVPPFGEMKCILCWCVSGETHCQR
QECPPDACASPTRRDNPCCAKCRAPDAPSEKMYEATAEAWSR
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccgccctgctgctgctcgccctgctcgccctgcccgtccgcaccgcccgcccc
aagctcgccctgcccatccggcccgacagcgagccgctgccccccgggggggcggcaggt
tgtgccttcgggggacgtttctacgcgctggaggagacgtggcaccccgacctgggggag
ccctttggggtgatgcgctgcgtgatctgccactgcgagacgcagaggaatcgccgaggg
aaaccagtggggaaagtgaactgcaagaacatgaagcaggattgccccgttcccacctgc
ccccgtgccacgctgttgcccgggcactgctgccatacctgtcccaaagccttgccagga
gccccggagaagagctacaagccaccttttgacacctttgagtacttccaggacaaggag
gacgagctggacaagccgtacaatgaccgctcctacctcagctctgagggttcggcacgt
gacgatgcccgcacagaattcgtggccctgctgacgagcggccccgagccgtggcacccc
acatccagcgcggtggccaaggctcgcttcaccctgctgcgctcctacctgctcttctcc
atcagctacgagcggctgggccggccgagccgtgtgcgtttcagtgaccccgagggcacc
gtgctgttcgagcacccagtgcagaagagcgcagcccctgaggacggcatgctctgtggg
atgtggaggacagtgtccaaagccaacatacagctgctgcgtgcggagcagctccgtgtg
tccctcatcacccgtgcgcagccctccggagaggtgcatgggcacatcctgaagcaccgg
gcgctctttgcagagacatttggtgccatcctgacctcatcagaccccgcgcacctgggg
gccgggggcatggccatgctgacgctgagcgacaccgagaacaacctacacttcatcctc
atggcccgtgggctgctggagcccggtgctgaggagtccccctgggtaccgctgcgggtc
cgcatcctgcaccagggccagacgctgcgcgaggcccatgccaacatcactatggaggac
cccgacttcgcggaggtactgagcgacctgtctgcccatgagctgcagtggttggcacag
gggcagctccgcatcgtggctgacacccagggccggcacccgcgccagctggagggcacc
attaccgcccgccgcagctgtgacaccatccaaagcgtgctgtgcggcgcagatgcattg
cagcccaccaagacgggggcggtgggctcggccaagctggcgctgcatgagaacggcacg
ctggagtaccaggtgcgggtggtgggcacggccagcgaggtggtgggggtcacactggag
accaaaccgcggcggaagaacaggaggaacgtcctcttcgacatgacacccagctatagg
gctgggatggctcaaggagtgtggcacagccccagcgcccgcgatgtgcacatgctgctg
cagaatgagctcttcctcaacgtggccaccaaggactgggcagagggagagctgcggggc
caggtcatctccctgccctacagtgggctcctggcacgctacacagagatgccggtgccg
ctggcagggcagctggtatcccccccagtgagcagcggggccgggggccacgcgtggctg
tcactggatgagcactgccacctgcactacgagatagtggtggcgggtctgggccgcccg
gccgatggcacagtcagtgcccagctgcacggcgtggccgagctgggcgagatgggcact
cggccgcacctgcacaagcggatgctcaaggggttctatggcactgaggctcagggggtg
gtgaaggacctggatgctgagctgctgcagcacctggcacagggcaccgcattcctgcaa
gtcagcaccaaagcacacccgcgtggggagatgcggggatgggtgcacatccccaaccgc
tgtcagccaggaggggcccgcctgtccaccggggaggctgagctctcagagggccctaag
ggcaggaatgtggaacagctgaaaaaggaccccaactcctgcttcttcgaggggcagcac
catgcacacggcacccgctgggcgcctgactacgacaagaagtgctccatctgcagctgc
cagaagcgcacggtcatctgcgatcccatcctgtgccagcccctcaactgtacccgccag
gtgcaccctgaggagctgtgctgccccatctgtgaagagaagaagatggagcaggaggag
ctgaagctggaacgggcacgggacagcagcgagggctgctactttgatggggacaagaca
tggcgaggctctggcacccgctggcaccctgtcgtgccgccgtttggcctcatcaaatgt
gccatctgcacctgcaagggcaccacgggtgaagtgcactgcgagaaggtgcagtgtccg
cgcctcacctgtgccaaccctgtgcgcgtcagcccctccgactgctgcaagcagtgccca
gcccctgagaagagcatccctgagctgactgatggcatgcaggcggacggaccccgtgcg
tgccgctttgggcgccgctggtacctcaacaacgagagctggcacccctcagtgccaccc
tttggggagatgaagtgcatcctgtgctggtgtgtgtcaggagagacccactgccagcgc
caggagtgcccgccagatgcctgtgccagccccaccaggagggacaacccctgctgtgcc
aagtgtcgcgctccggatgcaccctcagaaaagatgtacgaagccacagcagaggcatgg
agccgctga

DBGET integrated database retrieval system