KEGG   Gallus gallus (chicken): 395831
Entry
395831            CDS       T01006                                 

Gene name
EFNA2
Definition
(RefSeq) ephrin-A2 precursor
  KO
K05462  ephrin-A
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    395831 (EFNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    395831 (EFNA2)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    395831 (EFNA2)
Cytokines and growth factors [BR:gga04052]
 Growth factors
  Growth factors (RTK binding)
   395831 (EFNA2)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Axon guidance molecules
   395831 (EFNA2)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 395831
NCBI-ProteinID: NP_990314
CGNC: 49502
Ensembl: ENSGALG00000038629
UniProt: P52802
Position
28
AA seq 200 aa
MPRWEAAALLAAIVGVCVWSDDPGKVISDRYAVYWNRSNPRFHRGDYTVEVSINDYLDIY
CPHYEEPLPAERMERYVLYMVNYEGHASCDHRQKGFKRWECNRPDSPSGPLKFSEKFQLF
TPFSLGFEFRPGHEYYYISASPLNVVDRPCLKLKVYVRPTNDSLYESPEPIFTSNNSCCS
LAVPRAVLVAAPVFWTLLGS
NT seq 603 nt   +upstreamnt  +downstreamnt
atgccgcgctgggaggcggccgcgctgctcgccgcgatcgtcggcgtctgcgtgtggagc
gacgaccccggcaaagtgatctcggaccgctacgccgtctattggaaccgcagcaacccc
aggttccaccgcggggattacaccgtggaggtgagcatcaatgactacctggacatctac
tgccctcactacgaggagccgctgcccgccgagcgcatggagcgctacgtcctctacatg
gtcaactacgagggccacgcgtcctgcgaccaccggcagaagggcttcaaacgttgggag
tgcaaccggcccgactcccccagcggacccctcaagttctcagagaagttccagctcttc
acccccttctctttgggcttcgagttccgtcccggccacgagtattactacatctctgcg
tctcccctgaacgtggtggacagaccctgcctcaagctgaaggtttacgttcggccgacg
aacgattccctctatgagtccccagagcccatcttcaccagcaacaactcgtgctgcagc
cttgcagtgccgcgtgccgtgctggtggccgcgccggtcttctggactctgctgggctct
tag

DBGET integrated database retrieval system