KEGG   Gallus gallus (chicken): 395837
Entry
395837            CDS       T01006                                 

Gene name
FGG
Definition
(RefSeq) fibrinogen gamma chain precursor
  KO
K03905  fibrinogen gamma chain
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    395837 (FGG)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    395837 (FGG)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   395837 (FGG)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   395837 (FGG)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   395837 (FGG)
SSDB
Motif
Pfam: Fibrinogen_C Fib_alpha EzrA HAUS-augmin3 DUF489 TMF_DNA_bd SlyX IFT57
Other DBs
NCBI-GeneID: 395837
NCBI-ProteinID: NP_990320
CGNC: 7041
Ensembl: ENSGALG00000009268
UniProt: E1BV78
Structure
PDB: 
1M1J 1EI3

Position
4
AA seq 438 aa
MAPGEMGPKPGRWVPLGHLLSLLFSTSMAYIATRENCCILDERFGSYCPTTCGIADFFNK
YRLTTDGELLEIEGLLQQATNSTGSIEYLIQHIKTIYPSEKQTLPQSIEQLTQKSKKIIE
EIIRYENTILAHENTIQQLTDMHIMNSNKITQLKQKIAQLESHCQEPCKDTAEIQETTGR
DCQDIANKGARKSGLYFIKPQKAKQSFLVYCEIDTYGNGWTVLQRRLDGSEDFRRNWVQY
KEGFGHLSPDDTTEFWLGNEKIHLITTQSTLPYALRIELEDWSGKKGTADYAVFKVGTEE
DKYRLTYAYFIGGEAGDAFDGFNFGDDPSDKSYTYHNGMRFSTFDNDNDNFEGNCAEQDG
SGWWMNRCHAGHLNGQYYIGGVYSRDTGTNSYDNGIIWATWRDRWYSMKKTTMKIIPFNR
LSIDGQQHSGGLKQVGDS
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggcacccggtgagatggggccaaaaccaggcagatgggtgcctctagggcatctcctc
tctctgctcttctccaccagcatggcgtacattgctaccagagaaaactgctgcatatta
gatgagcgatttggtagctactgccccacaacttgtggcattgcagatttctttaacaaa
taccgtctcactacggatggtgaactgttagaaattgagggacttctgcagcaagctact
aactccacaggatcaatagaatatttgattcaacacatcaaaaccatctatccttcagag
aagcagacactaccacaatctattgagcaattgactcagaagtccaagaaaataattgaa
gaaattatcagatatgaaaacactattttggctcatgaaaatactatacaacagttgaca
gatatgcatataatgaacagcaacaagatcacacaactgaaacagaagattgctcagctt
gagtcacactgccaggaaccatgcaaagatactgctgaaatacaggagacaactggaaga
gattgtcaagatattgcaaataaaggtgccagaaaaagtggtctttacttcatcaagcct
caaaaagctaagcagtcattcctagtctactgtgagattgacacatatggcaacggctgg
acagtattacagaggagattggatgggagtgaggacttccggagaaattgggttcaatac
aaggaaggatttggacatctgtcaccagatgacaccacagaattttggctgggcaatgaa
aagattcatttaataactacacagtccactctgccatatgccttgcgaatagaattggag
gactggtctggcaaaaaaggcactgctgactatgccgtgttcaaagtgggaactgaagaa
gacaagtacagactgacctatgcctactttattggtggcgaagctggagatgcttttgat
ggctttaattttggagatgatccaagtgacaaatcctatacctaccataatggcatgcgc
ttcagcacctttgataatgacaatgacaactttgagggcaactgtgctgagcaagatgga
tctggatggtggatgaatagatgccatgctggtcacctcaatggacaatattatataggt
ggtgtgtactctagagatactggtacaaattcatatgacaatggcattatatgggcaaca
tggcgtgaccgatggtactccatgaagaaaactacaatgaaaatcatcccattcaacaga
ctctcaatagatggacagcagcactcaggaggcctcaagcaggttggagactcataa

DBGET integrated database retrieval system