KEGG   Gallus gallus (chicken): 395839
Entry
395839            CDS       T01006                                 

Gene name
GFRA4
Definition
(RefSeq) GDNF family receptor alpha-4 precursor
  KO
K19895  GDNF family receptor alpha
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:gga00537]
    395839 (GFRA4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:gga00537]
 Receptors
  395839 (GFRA4)
SSDB
Motif
Pfam: GDNF
Other DBs
NCBI-GeneID: 395839
NCBI-ProteinID: NP_990322
CGNC: 49506
Ensembl: ENSGALG00000036589
UniProt: O93512
Position
4
AA seq 431 aa
MRGILYFCTLILLEGMAEAVSSSRDCLQAGESCTNDPICSSKFRTLRQCIAGNGANKLGP
DAKNQCRSTVTALLSSQLYGCKCKRGMKKEKHCLSVYWSIHHTLMEGMNVLESSPYEPFI
RGFDYVRLASITAGSENEVTQVNRCLDAAKACNVDEMCQRLRTEYVSFCIRRLARADTCN
RSKCHKALRKFFDRVPPEYTHELLFCPCEDTACAERRRQTIVPACSYESKEKPNCLAPLD
SCRENYVCRSRYAEFQFNCQPSLQTASGCRRDSYAACLLAYTGIIGSPITPNYIDNSTSS
IAPWCTCNASGNRQEECESFLHLFTDNVCLQNAIQAFGNGTYLNAATAPSISPTTQMYKQ
ERNANRAAATLSENIFEHLQPTKVAGEERLLRGSTRLSSETSSPAAPCHQAASLLQLWLP
PTLAVLSHFMM
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgaggggcatcctctacttctgcacgctgatcctcctggaaggtatggcagaagctgtc
agctcaagcagggactgccttcaggcaggtgagtcctgcaccaacgaccccatctgcagc
tccaaattcaggaccctccggcagtgtatcgcaggtaatggagccaacaagctgggcccc
gacgccaagaaccagtgtcggagcacagtgactgccctgctctccagccagctctacggc
tgcaagtgcaagcgaggcatgaaaaaggagaagcattgcttgagtgtctactggagcatc
caccatacgctgatggaaggcatgaacgtgctggaaagttctccttatgagccattcatc
aggggctttgattatgtccggctggcctccatcactgcagggtctgagaacgaggtgacc
caggtgaaccgctgcctggacgccgccaaagcctgcaacgtggacgagatgtgccaacgg
ctgcggacggaatatgtctccttctgcatccggcgcctggcccgggccgacacctgcaac
cgctccaagtgccataaggccttacgcaagttcttcgaccgcgtgccgcccgagtacacc
cacgagctgctcttctgcccctgcgaagacacagcctgtgctgaacgccggcggcagacc
atcgttccggcctgctcctatgagtccaaggagaaacccaactgcctggcaccgctggac
tcctgccgcgagaactacgtctgtaggtcgcgttatgcagagttccagtttaattgccaa
ccatccctgcagactgcgagtggctgccggagggacagctatgctgcctgcctgctggct
tacaccgggatcataggcagccccatcactcccaactacattgacaactcgacctccagc
atagcaccctggtgcacgtgcaacgcaagtggcaaccggcaggaagagtgcgagagcttc
ctgcacctcttcactgacaacgtctgtctccaaaatgccatccaggcctttggcaacggg
acctacctgaacgcagccacagccccatccatctcccccaccacgcagatgtacaagcag
gagcgaaacgccaacagagctgcagcaaccctcagcgagaacatcttcgagcacctccag
cctaccaaggtggctggagaggagaggctcctgcggggctccactcgtctgtcatcagag
acctccagcccagcagctccttgccaccaggcagcctccctgctgcagctgtggcttccc
cccactcttgctgtgctgagccacttcatgatgtga

DBGET integrated database retrieval system