KEGG   Gallus gallus (chicken): 395841
Entry
395841            CDS       T01006                                 

Gene name
AvBD1
Definition
(RefSeq) gallinacin-1 alpha precursor
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Defensin_beta
Other DBs
NCBI-GeneID: 395841
NCBI-ProteinID: NP_990324
CGNC: 49508
Ensembl: ENSGALG00000022815
UniProt: P46156
Position
3
AA seq 65 aa
MRIVYLLLPFILLLAQGAAGSSQALGRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCC
KRIWG
NT seq 198 nt   +upstreamnt  +downstreamnt
atgcggatcgtgtacctgctcctccccttcatcctcctcctggcccagggtgctgcagga
tcctcccaggctctaggaaggaagtcagattgttttcgaaagagtggcttctgtgcattt
ctgaagtgcccttccctcactctcatcagtgggaaatgctcaagattttacctctgctgc
aaaagaatatggggctga

DBGET integrated database retrieval system