KEGG   Gallus gallus (chicken): 395846Help
Entry
395846            CDS       T01006                                 

Gene name
GJA8
Definition
(RefSeq) gap junction alpha-8 protein
  KO
K07617  gap junction alpha-8 protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    395846 (GJA8)
Transporters [BR:gga02000]
 Other Transporters
  Pores ion channels [TC:1]
   395846 (GJA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Connexin Connexin50 Connexin40_C
Motif
Other DBs
NCBI-GeneID: 395846
NCBI-ProteinID: NP_990328
CGNC: 11546
Ensembl: ENSGALG00000015488
UniProt: P36381
Position
1
AA seq 400 aa AA seqDB search
MGDWSFLGNILEQVNEQSTVIGRVWLTVLFIFRILILGTAAELVWGDEQSDFVCNTQQPG
CENVCYDEAFPISHIRLWVLQIIFVSTPSLVYFGHAVHHVRMEEKRKEREEAERRQQAEV
DEEKLPLAPNQNKGNNPDGTKKFRLEGTLLRTYILHIIFKTLFEVGFIVGQYFLYGFRIL
PLYRCGRWPCPNLVDCFVSRPTEKTIFIMFMLVVAAVSLFLNLVEISHLILKRIRRALRR
PAEEQMGEVPEKPLHAIAVSSIPKAKGYKLLEEEKPVSHYFPLTEVGVEPSPLPSAFNEF
EEKIGMGPLEDLSRAFDERLPSYAQAKEPEEEKVKAEEEEEQEEEQQAPQEEPGVKKAEE
EVVSDEVEGPSAPAELATDVRSLSRLSKASSRARSDDLTV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgggtgactggagtttcttggggaacattttagagcaggtgaacgagcagtccactgtc
atcgggagagtttggctcacggtgctcttcattttccgcatcctgatcctgggaacagct
gctgaactagtatggggagatgaacagtcagactttgtgtgcaacacccagcaacctggt
tgtgagaacgtctgctatgatgaggccttccccatctcccacatccggctctgggtccta
cagatcatttttgtatccacgccttcgctagtgtactttgggcatgcggtgcaccatgtc
cgcatggaggagaagaggaaagagagggaggaagctgagaggcgtcagcaagctgaggtg
gatgaagagaagctgcccctagctccaaatcaaaacaagggcaacaacccagatgggacc
aagaagtttcgcctggaggggaccctcctgagaacctacatcctccacatcattttcaaa
actctctttgaagtgggattcattgttggccagtatttcctgtatggcttccgcattctc
cccctttaccgctgtgggcggtggccctgtcccaacctagtggactgttttgtctccagg
cccacagagaagaccatctttattatgttcatgctcgtggtggctgctgtgtccctcttc
ctcaacctggtggagatcagccacttgatcctgaaaaggatccggagggctctgagaaga
ccagcagaggagcagatgggggaggtgccagagaagcccctccatgctattgcagtgtcc
tccatcccgaaggccaaaggctacaagctgctagaagaagaaaagccagtgtcccactat
ttccctctcacggaagtaggggttgagcccagtccccttccatcagccttcaatgagttt
gaggagaagattgggatggggccactggaagatctctccagggcatttgatgagaggtta
ccatcgtatgcacaagcgaaggaaccggaagaggagaaggtaaaagcagaggaggaagag
gaacaagaagaggagcagcaagcacctcaggaagagccaggggtgaagaaagcagaggag
gaggtggtgagcgatgaagtggaagggccttcagcacctgctgaacttgccaccgatgtg
agatccctcagcaggctaagtaaagccagcagccgggccaggtcagacgatctgactgta
tga

DBGET integrated database retrieval system