KEGG   Gallus gallus (chicken): 395853
Entry
395853            CDS       T01006                                 

Gene name
HSPA8
Definition
(RefSeq) heat shock cognate 71 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
gga  Gallus gallus (chicken)
Pathway
gga03040  Spliceosome
gga04010  MAPK signaling pathway
gga04141  Protein processing in endoplasmic reticulum
gga04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    395853 (HSPA8)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    395853 (HSPA8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    395853 (HSPA8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    395853 (HSPA8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    395853 (HSPA8)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gga03041]
    395853 (HSPA8)
   03009 Ribosome biogenesis [BR:gga03009]
    395853 (HSPA8)
   03110 Chaperones and folding catalysts [BR:gga03110]
    395853 (HSPA8)
   04131 Membrane trafficking [BR:gga04131]
    395853 (HSPA8)
   03051 Proteasome [BR:gga03051]
    395853 (HSPA8)
   03029 Mitochondrial biogenesis [BR:gga03029]
    395853 (HSPA8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    395853 (HSPA8)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     395853 (HSPA8)
Spliceosome [BR:gga03041]
 Complex B
  Other components
   Prp19 complex
    395853 (HSPA8)
 Complex C
   Prp19-CDC5 complex
    395853 (HSPA8)
Ribosome biogenesis [BR:gga03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    395853 (HSPA8)
Chaperones and folding catalysts [BR:gga03110]
 Heat shock proteins
  HSP70 / DNAK
   395853 (HSPA8)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    395853 (HSPA8)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    395853 (HSPA8)
Proteasome [BR:gga03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    395853 (HSPA8)
Mitochondrial biogenesis [BR:gga03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    395853 (HSPA8)
Exosome [BR:gga04147]
 Exosomal proteins
  Proteins found in most exosomes
   395853 (HSPA8)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR
Other DBs
NCBI-GeneID: 395853
NCBI-ProteinID: NP_990334
CGNC: 49511
Ensembl: ENSGALG00000006512
UniProt: O73885
Position
24
AA seq 646 aa
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDSVVQSDMKHWPFTVVNDAGRPKVQVEYKGETKSFYPEEIS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQGTKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNLLIFDLGGGTFDVSILTIENGIFEVKSTAGDTHLGGEDFDNRLVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEKLNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLDSYAFNMKATVEDEKLPGKILDEDHQNILDKCNEIINWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgtcaaagggaccagctgttggtatcgatcttggaaccacctattcctgtgttggtgtg
ttccaacatgggaaggtggaaatcattgccaatgaccagggtaacaggaccacgccaagc
tacgtcgctttcacagatacagagaggttgattggcgatgctgccaagaaccaagttgca
atgaatcccaccaacacagtcttcgatgcaaaacggttgattgggcgtagatttgatgat
tctgttgtccagtctgatatgaagcattggcctttcactgtggtgaatgatgctggcagg
ccaaaagtccaggtggaatacaaaggagagacaaagagcttctacccagaagaaatttct
tccatggtcctaacgaaaatgaaggaaattgcagaagcatatcttgggaagactgtaact
aatgctgtagtcactgtaccagcctattttaacgactcccagcgacagggcacaaaagat
gctggaaccattgcagggctcaatgttctgcgaattatcaatgaaccaacagctgctgct
atagcctacggtctggataagaaagttggtgctgaaaggaaccttcttatttttgacctt
ggaggtggcacctttgatgtgtcaatcctgactattgaaaatggcatctttgaggtgaaa
tccactgcaggtgacactcatttgggtggagaagattttgacaaccgcttggtcaaccac
ttcattgctgaattcaagcgcaagcacaagaaagacatcagtgagaacaagagagcagtt
cgtcgccttcgtactgcatgtgaacgtgcaaagcgtaccctgtcatcaagcacacaagcc
agtattgaaatcgattctctctatgagggtattgacttctacacatcgatcaccagagct
cgcttcgaaaagctgaatgctgacctgttccgtggcaccctggatcctgtggagaaggcc
ctgcgggatgccaagctagacaagtcacagatccatgacattgtgctggttggggggtct
acccgcatcccaaagattcagaaactgctgcaagacttcttcaacggcaaagagttgaac
aagagcatcaatcctgatgaagctgtggcttatggtgcagctgttcaagctgcaattctg
tctggggacaagtccgagaacgtccaagatctgctcctgttggatgtgactcctctgtct
ctgggtattgagactgctggaggtgtcatgacagtcttgatcaagcgcaataccaccatt
cccaccaagcagactcagacgttcactacttactctgacaaccagcctggtgtgctgatt
caggtatatgaaggagaacgtgctatgactaaggacaacaacttgctgggcaagtttgag
ctgaccggtattccccctgctcccagaggtgtacctcagattgaagtaaccttcgatatt
gatgccaatggcatcctgaatgtgtctgctgtggataagagcactggcaaggagaacaag
atcacgataacaaatgacaaaggccggcttagcaaggaagacattgagcggatggttcag
gaagcagagaaatacaaggcagaagatgagaagcagcgtgataaagtgtcttctaagaac
tccctggattcttatgcattcaacatgaaagctactgttgaagatgagaagctccctggc
aagattcttgatgaggaccaccagaacatcctggacaaatgcaatgaaatcatcaactgg
ctggacaagaatcagactgctgagaaggaagagtttgagcaccagcagaaagaactggag
aaggtgtgcaaccccatcatcaccaagctgtaccagagcgcaggtgggatgcctggagga
atgcctgggggcttccctggtggtggagctcctccctctggtggagcttcttctggacca
accattgaggaggtggattaa

DBGET integrated database retrieval system