KEGG   Gallus gallus (chicken): 395854
Entry
395854            CDS       T01006                                 

Gene name
GDI2
Definition
(RefSeq) rab GDP dissociation inhibitor beta
  KO
K17255  Rab GDP dissociation inhibitor
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    395854 (GDI2)
Exosome [BR:gga04147]
 Exosomal proteins
  Proteins found in most exosomes
   395854 (GDI2)
SSDB
Motif
Pfam: GDI Myc_N Amino_oxidase
Other DBs
NCBI-GeneID: 395854
NCBI-ProteinID: NP_990335
CGNC: 49512
Ensembl: ENSGALG00000008169
UniProt: O93382
Position
1
AA seq 448 aa
MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNSYYGGESASITPLEDLYKRFNLPG
TPPESMGRGRDWNVDLIPPFLMANGQLVKMLLYTEVTRYLDFKVIEGSFVYKGGKIYKVP
STEAEALASSLMGLFEKRRFRKFLVYVANFDENDPRTFEGVDPKKTTMRDVYKKFDLGQD
VIDFTGHALALYRTDDYLDQPCQETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR
LSAIYGGTYMLNKPIEEIVIENGKVVGVKSEGEVARCKQLICDPSYVSDRVTKVGQVIRV
ICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISSAHNVAAQGKYIAIASTTVETA
DPEKEIKPALDLLEPIEQKFVSISDLFAPTDLGTESQIFISRTYDATTHFETTCDDIKDI
YKRMMGSEFDFEEMKRKKNDIYGEEEQQ
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgaatgaggagtacgacgtgatcgtgctgggcaccggcctgacggaatgcatcctctct
gggatcatgtcagtgaatggaaagaaggtccttcacatggatcgtaactcttactatgga
ggggaaagcgcatccattacacccctggaggatctctataaaaggtttaatctaccagga
actccaccagaatctatgggacgaggaagagactggaacgtggacctaattccacccttc
cttatggctaacggtcagctggtaaagatgttgctctacacagaagtcactcgctactta
gacttcaaggtgatcgagggaagctttgtctacaagggaggcaagatctacaaagttcct
tccactgaggcagaagccttggcatccagcttaatgggtttgttcgagaagcgccggttc
aggaagttcttagtgtacgtcgccaactttgatgagaacgacccccggactttcgaaggc
gttgaccccaagaagaccaccatgcgtgatgtgtataagaaatttgacctggggcaggat
gttattgacttcacaggccatgccctcgccttgtacaggactgacgattacctagatcaa
ccatgccaagaaacaatcaacaggattaagctctacagtgagtctctggctcggtacggg
aaaagcccatacctttatcccctctatggccttggagagctgccacagggatttgcaagg
ctaagtgctatatatggaggcacctacatgctgaacaagcccattgaggagattgtgata
gaaaatggcaaagtggttggtgtgaagtctgaaggggaggttgctcgctgcaaacagctc
atctgcgaccccagctacgtctcggaccgtgtcacaaaggttggccaagtgatccgggta
atctgcatcctgagccacccgatcaagaacacgaacgatgccaactcgtgccagatcatc
attccacagaatcaggtcaaccggaagtcagatatctacgtctgcatgatctcctctgca
cacaacgtggcagcgcaggggaagtacatcgccattgccagcactactgtggaaaccgcg
gacccagagaaagagatcaagccggccttggacctcttggagcccattgagcagaagttt
gttagcatcagcgacctgtttgcaccgaccgacctgggaactgagagccagatcttcatt
tctcgcacctatgacgctaccactcactttgagacaacgtgcgacgacatcaaagatatt
tataagaggatgatgggatcagagtttgactttgaagagatgaaacgcaagaagaacgat
atctacggggaggaggagcagcagtaa

DBGET integrated database retrieval system