KEGG   Gallus gallus (chicken): 395855
Entry
395855            CDS       T01006                                 

Gene name
CALM2
Definition
(RefSeq) calmodulin
  KO
K02183  calmodulin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04070  Phosphatidylinositol signaling system
gga04114  Oocyte meiosis
gga04218  Cellular senescence
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04371  Apelin signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04744  Phototransduction
gga04910  Insulin signaling pathway
gga04912  GnRH signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    395855 (CALM2)
   04020 Calcium signaling pathway
    395855 (CALM2)
   04070 Phosphatidylinositol signaling system
    395855 (CALM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    395855 (CALM2)
   04218 Cellular senescence
    395855 (CALM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    395855 (CALM2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    395855 (CALM2)
   04912 GnRH signaling pathway
    395855 (CALM2)
   04916 Melanogenesis
    395855 (CALM2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    395855 (CALM2)
   04270 Vascular smooth muscle contraction
    395855 (CALM2)
  09157 Sensory system
   04744 Phototransduction
    395855 (CALM2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    395855 (CALM2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    395855 (CALM2)
   03036 Chromosome and associated proteins [BR:gga03036]
    395855 (CALM2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    395855 (CALM2)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     395855 (CALM2)
Membrane trafficking [BR:gga04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    395855 (CALM2)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Centriole replication proteins
     395855 (CALM2)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   395855 (CALM2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg EF-hand_11 UPF0154 EFhand_Ca_insen DUF1103 Caleosin Dockerin_1 DUF5580 TerB SurA_N_2 Poly_export DUF2267 RTX_C DUF6279 MecA_N Fe_hyd_lg_C
Other DBs
NCBI-GeneID: 395855
NCBI-ProteinID: NP_990336
CGNC: 49513
Ensembl: ENSGALG00000010023
UniProt: O93410
Structure
PDB: 
2VB6 2M3S

Position
3
AA seq 149 aa
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE
QVDEMIRESDIDGDGQVNYEEFVQMMTAK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctgatcaactgacagaagagcagattgcagaattcaaagaagctttttcactattt
gacaaggatggtgatggtactataactacaaaggagttggggactgtgatgagatcactt
ggtcagaaccccacagaagcagaattacaggacatgatcaatgaagtagacgctgatggc
aatggcacaattgacttcccagagtttctgacaatgatggcaagaaaaatgaaagataca
gatagcgaagaagaaattagagaagcgttccgtgtgtttgacaaggatggtaatggttac
attagtgctgcagaacttcgtcatgtgatgacaaatcttggggagaagctaacagatgaa
caagttgatgaaatgattagggaatcagacattgatggtgatggtcaagtaaactatgaa
gagtttgtacaaatgatgacagcgaagtga

DBGET integrated database retrieval system