KEGG   Gallus gallus (chicken): 395856
Entry
395856            CDS       T01006                                 

Gene name
FOXC1
Definition
(RefSeq) forkhead box protein C1
  KO
K09396  forkhead box protein C
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395856 (FOXC1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    395856 (FOXC1)
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 395856
NCBI-ProteinID: NP_990337
CGNC: 49514
UniProt: O93440
Position
2
AA seq 528 aa
MGNPMSVYSGHAEQYAAGMGRSYGPYHPHQPAAPKDLVKPPYSYIALITMAIQNAPDKKI
TLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSY
NMFENGSFLRRRRRFKKKDAVKDKEEKDRLHLKDHAPPPPRPPPTAATGAEPEGGGPPAA
GAAPPPVRIQDIKTENGTASPPQAVSPPGAAPPLGAVPKIESPDSSSSLSSGGSPRGGAL
PAARSLGMEGPEPPPPPPPPPPPPPPPPHHHGPGFSVDNIMTSLRGSPQAAELGAGLLPP
AAAAPRSSLPPALSLGAYSPGHSSAVYGSPCGQPAAAAAGSYHCNMQSMSLFTRRRGATS
GPAGHLPAASPAEDPLPDYAMPGGGGGGAANGGAGSGGGPGGGGGGGGGAGGGHQEGHHP
HPHPHQGRLASWYLNQAAAAAAAAAAAAGELGYAGPQQSFAAGPRDVFEAPRDGAQRLAR
RRRRRRRRQRGERRRRWSGGRRQLSDGVPGSQPLYAPPGTFVYDCGKF
NT seq 1587 nt   +upstreamnt  +downstreamnt
atgggcaaccccatgagcgtgtattcaggccacgccgagcagtacgcggcgggcatgggg
cgatcctacggcccctaccacccgcaccaacccgccgcccccaaggacctggtgaagccg
ccctacagctacatcgcgctcatcaccatggccatccagaacgcgcccgataagaagatc
accctcaacgggatctaccagttcatcatggagcgcttccccttctaccgggacaacaag
cagggctggcagaactccatccgccacaacctgtccctcaacgagtgcttcgtcaaggtg
ccccgcgacgacaagaagcccggcaagggcagctactggacgctggaccccgactcctac
aacatgttcgagaacggcagcttcctgcgccgccgccgccgcttcaagaagaaggacgcc
gtcaaggacaaggaggagaaggaccgcctgcacctcaaggaccatgccccgccgccgccg
cgcccgccgcccaccgccgccaccggcgccgagcccgagggcgggggccctcccgcggcc
ggggccgctccgccgccggtgcgcatccaggacatcaagacggagaacggcacggcctcc
ccgccgcaggccgtgtccccgccgggcgccgcgccgccgctgggcgccgtgcccaagatc
gagagccccgacagcagcagcagcctctcgagcggcggcagcccccgcggcggcgcgctc
cccgccgcccgctccctcggcatggagggccccgagccgcctccccctcctcctccgcct
cctcctccgcctcccccccctccgcaccaccacgggccgggcttcagcgtggacaacatc
atgacctcgctgcggggctccccgcaggcggccgaactgggcgccggcctgctgcccccc
gccgccgccgcccctcgcagctcgctgccgcccgccctctcgctcggcgcctactcgccg
ggccacagctccgcggtgtacggctcgccctgcggccagcccgccgccgccgccgccggc
tcctaccactgcaacatgcagtccatgagcctttttacgcggcggcggggggcaacgagc
ggcccggccggccacctgcccgccgccagccccgctgaggatccgctgcccgattacgcc
atgcccggcgggggcggcggcggggcggccaacggcggcgcggggagcggcggcggcccg
ggcggcggcggcggcggcggcggcggggcggggggcggccaccaggaggggcaccacccg
cacccgcacccgcaccagggccgcttggcctcctggtacctcaaccaggcggctgcggcg
gcggcggcggcggcggcggcggcgggggagctgggctacgcggggccgcagcagagcttc
gccgccggtccgcgggacgtcttcgaagcgccgcgggatggggctcagcgcctcgcccgg
aggcggaggaggcggcggcggaggcaacgcggggagcggcggcggcggtggagcgggggg
cggcggcagctgtcagatggcgttcccggcagccagccgctgtacgcgcctccggggacc
ttcgtctacgactgcggcaagttctga

DBGET integrated database retrieval system