KEGG   Gallus gallus (chicken): 395862
Entry
395862            CDS       T01006                                 

Gene name
PITX2
Definition
(RefSeq) pituitary homeobox 2
  KO
K04686  paired-like homeodomain transcription factor 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    395862 (PITX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395862 (PITX2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, not assigned
    395862 (PITX2)
SSDB
Motif
Pfam: Homeodomain OAR Homeobox_KN XRCC4
Other DBs
NCBI-GeneID: 395862
NCBI-ProteinID: NP_990341
CGNC: 66216
Ensembl: ENSGALG00000042492
UniProt: O93385
Position
4
AA seq 333 aa
MSCMKDPLSLERLGAGNNKLCSSSPSSSSSSSSCHHQQPALAMATALAPGQARSSLEAAK
HRLEVHTISDTSSPEAAEKEKSQQGKSEDAGPEDPSKKKRQRRQRTHFTSQQLQELEATF
QRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLM
QPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSS
SMVPSAVTGVPGSGLNSLNNLNNLSNPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASL
RLKAKQHSSFGYASVQNPASNLSACQYPVDRPV
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgagttgcatgaaggacccgttaagcctggagcgcctgggagccgggaataataagctg
tgctcctcctcaccttcctcctcctcctcctcgtcctcctgccatcaccagcagcccgcg
ctggccatggcgacggcgctggcgccggggcaggctcgctcctccctggaggccgccaag
caccggctggaggtgcacactatctctgacacctccagccccgaggccgcagagaaagag
aagagccagcagggcaagagcgaggatgcggggcccgaggacccctccaagaagaagcgg
cagcggcggcagcggacgcacttcaccagccagcagctgcaggagctggaggccaccttc
cagcggaaccgctaccccgacatgtccacccgcgaggagatcgccgtctggaccaacctc
accgaggcccgggttcgggtttggttcaagaaccgcagagccaaatggaggaagagagag
aggaaccagcaggccgagctgtgcaagaacggcttcgggccgcagttcaatggcctgatg
cagccctacgatgacatgtaccccgggtactcgtacaacaactgggcagccaagggcctc
acctccgcctccctctccaccaagagcttccccttcttcaactccatgaatgtcaacccg
ctgtcctcccagagcatgttctcccctcccaactccatctcctccatgagcatgtcctcc
agcatggtgccctcggcggtcaccggcgtgcccggctccggcctcaacagcctgaacaac
ttgaacaacctgagcaacccctccctcaactcggcagtgcccacgccggcctgtccgtac
gcccctccgacgcctccatacgtttatagggacacgtgtaactcgagcttggccagcctg
agactcaaagccaagcagcactccagctttggctacgccagcgtgcagaaccccgcgtcc
aacctgagcgcctgccagtaccccgtggacaggcccgtgtga

DBGET integrated database retrieval system