KEGG   Gallus gallus (chicken): 395875Help
Entry
395875            CDS       T01006                                 

Gene name
COL12A1
Definition
(RefSeq) collagen alpha-1(XII) chain precursor
  KO
K08132  collagen, type XII, alpha
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:gga00535]
    395875 (COL12A1)
Proteoglycans [BR:gga00535]
 Extracellular matrix (ECM) proteoglycans
  Collagen family
   395875 (COL12A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 VWA VWA_2 Collagen Pur_ac_phosph_N Interfer-bind Copine Toxin_R_bind_N
Motif
Other DBs
NCBI-GeneID: 395875
NCBI-ProteinID: NP_990352
CGNC: 49526
Ensembl: ENSGALG00000015908
UniProt: A0A1L1RPW4
Position
3
AA seq 3122 aa AA seqDB search
MRTALCSAVAALCAAALLSSIEAEVNPPSDLNFTIIDEHNVQMSWKRPPDAIVGYRITVV
PTNDGPTKEFTLSPSTTQTVLSDLIPEIEYVVSIASYDEVEESLPVFGQLTIQTGGPGIP
EEKKVEAQIQKCSISAMTDLVFLVDGSWSVGRNNFRYILDFMVALVSAFDIGEEKTRVGV
VQYSSDTRTEFNLNQYFRRSDLLDAIKRIPYKGGNTMTGEAIDYLVKNTFTESAGARKGF
PKVAIVITDGKAQDEVEIPARELRNIGVEVFSLGIKAADAKELKLIASQPSLKHVFNVAN
FDGIVDIQNEIILQVCSGVDEQLGELVSGEEVVEPASNLVATQISSKSVRITWDPSTSQI
TGYRVQFIPMIAGGKQHVLSVGPQTTALNVKDLSPDTEYQINVYAMKGLTPSEPITIMEK
TQQVKVQVECSRGVDVKADVVFLVDGSYSIGIANFVKVRAFLEVLVKSFEISPRKVQISL
VQYSRDPHMEFSLNRYNRVEDIIQAINTFPYRGGSTNTGKAMTYVREKVFVTSKGSRPNV
PRVMILITDGKSSDAFKEPAIKLRDADVEIFAVGVKDAVRTELEAIASPPAETHVYTVED
FDAFQRISFELTQSVCLRIEQELAAIRKKSYVPAKNMVFSDVTSDSFKVSWSAAGSEVLS
YLIKYKVAIGGDEFIVSVPASSTSSVLTNLLPETTYAVSVIAEYEDGDGPPLDGEETTLE
VKGAPRNLRITDETTDSFIVGWTPAPGNVLRYRLVYRPLTGGERRQVTVSANERSTTLRN
LIPDTRYEVSVIAEYQSGPGNALNGYAKTDEVRGNPRNLRVSDATTSTMKLSWSAAPGKV
QQYFITYTPVAGGETKELTVKGDTTSKVLKGLDEATRYALTVSALYASGAGEALSGEGET
LEERGSPRNLITTDITDTTVGLSWTPAPGTVNNYRIVWKSLYDDTMGEKRVPGNTVDAVL
DGLEPETKYRISVYAAYSSGEGDPVEGEAFTDVSQSARTVTVDNETENTMRVSWQPSPGK
VLSYRVYYRPRSGGRQMFGKVNASATSIVLKRLKPRTTYDLSVVPIYDFGQGKSRKAEGT
TASPFKPPRNLRTSDSTMSSFRVTWEPAPGRVKGYKVTFHPTEDDRNLGELIVGPYDSTV
VLEELRAGTTYKVNVFGMFDGGESNPLVGQEMTTLSDTTTEPFLSRGLECRTRAEADIVL
LVDGSWSIGRPNFKTVRNFISRIVEVFDIGPDKVQIGLAQYSGDPRTEWNLNAYRTKEAL
LEAVTNLPYKGGNTLTGMALDFILKNNFKQEAGLRPRARKIGVLITDGKSQDDVVTPSRR
LRDEGVELYAIGIKNADENELKQIATDPDDIHAYNVADFSFLASIVEDVTTNLCNSVKGP
GDLPPPSNLVISEVTPHSFRLRWSPPPESVDRYRVEYYPTTGGPPKQFYVSRMETTTVLK
DLTPETEYIVNVFSVVEDESSEPLIGREITYPLSSVRNLNVYDIGSTSMRVRWEPVNGAT
GYLLTYEPVNATVPTTEKEMRVGPSVNEVQLVDLIPNTEYTLTAYVLYGDITSDPLTSQE
VTLPLPGPRGVTIRDVTHSTMNVLWDPAPGKVRKYIIRYKIADEADVKEVEIDRLKTSTT
LTDLSSQRLYNVKVVAVYDEGESLPVAAEAVTQPVPSPVNLRITEITKNSFRGTWDHGAP
DVSLYRITWGPYGRSEKAESIVNGDVNSLLFENLNPDTLYEVSVTAIYPDESESDDLIGS
ERTLPLVPITTPAPKSGPRNLQVYNATSHSLTVKWDPASGRVQRYKIIYQPINGDGPEQS
TMVGGRQNSVVIQKLQPDTPYAITVSSMYADGEGGRMTGRGRTKPLTTVKNMLVYDPTTS
TLNVRWDHAEGNPRQYKVFYRPTAGGAEEMTTVPGNTNYVILRSLEPNTPYTVTVVPVFP
EGDGGRTTDTGRTLERGTPRNIQVYNPTPNSMNVRWEPAPGPVQQYRVNYSPLSGPRPSE
SIVVPANTRDVMLERLTPDTAYSINVIALYADGEGNPSQAQGRTLPRSGPRNLRVFDETT
NSLSVQWDHADGPVQQYRIIYSPTVGDPIDEYTTVPGIRNNVILQPLQSDTPYKITVVAV
YEDGDGGQLTGNGRTVGLLPPQNIYITDEWYTRFRVSWDPSPSPVLGYKIVYKPVGSNEP
MEVFVGEVTSYTLHNLSPSTTYDVNVYAQYDSGMSIPLTDQGTTLYLNVTDLTTYKIGWD
TFCIRWSPHRSATSYRLKLNPADGSRGQEITVRGSETSHCFTGLSPDTEYNATVFVQTPN
LEGPPVSVREHTVLKPTEAPTPPPTPPPPPTIPPARDVCRGAKADIVFLTDASWSIGDDN
FNKVVKFVFNTVGAFDLINPAGIQVSFVQYSDEAKSEFKLNTFDDKAQALGALQNVQYRG
GNTRTGKALTFIKEKVLTWESGMRRGVPKVLVVVTDGRSQDEVRKAATVIQHSGFSVFVV
GVADVDYNELAKIASKPSERHVFIVDDFDAFEKIQDNLVTFVCETATSTCPLIYLEGYTS
PGFKMLESYNLTEKHFASVQGVSLESGSFPSYVAYRLHKNAFVSQPIREIHPEGLPQAYT
IIMLFRLLPESPSEPFAIWQITDRDYKPQVGVVLDPGSKVLSFFNKDTRGEVQTVTFDND
EVKKIFYGSFHKVHIVVTSSNVKIYIDCSEILEKPIKEAGNITTDGYEILGKLLKGDRRS
ATLEIQNFDIVCSPVWTSRDRCCDLPSMRDEAKCPALPNACTCTQDSVGPPGPPGPAGGP
GAKGPRGERGLTGSSGPPGPRGETGPPGPQGPPGPQGPNGLSIPGEPGRQGMKGDAGQPG
LPGRSGTPGLPGPPGPVGPPGERGFTGKDGPTGPRGPPGPAGAPGVPGVAGPSGKPGKPG
DRGTPGTPGMKGEKGDRGDIASQNMMRAVARQVCEQLINGQMSRFNQMLNQIPNDYYSNR
NQPGPPGPPGPPGAAGTRGEPGPGGRPGFPGPPGVQGPPGERGMPGEKGERGTGSQGPRG
LPGPPGPQGESRTGPPGSTGSRGPPGPPGRPGNAGIRGPPGPPGYCDSSQCASIPYNGQG
FPEPYVPESGPYQPEGEPFIVPMESERREDEYEDYGVEMHSPEYPEHMRWKRSLSRKAKR
KP
NT seq 9369 nt NT seq  +upstreamnt  +downstreamnt
atgaggacagcgctgtgctcggcggtggctgcgctgtgtgccgccgccctcctctcctcc
atcgaggctgaagttaatccaccgtcagacttgaattttacaattatagatgaacataat
gttcaaatgtcatggaaaaggccaccagatgcaatagtgggttacaggataactgtggtt
cctacaaatgatggaccgactaaagaatttactctttcacctagcacaacccaaactgtc
ttatcagatcttatacctgaaatagagtatgttgtatcaatagcttcatatgatgaggta
gaggagagtctacctgtttttggccaactaacaattcagacaggtggtccaggcatacca
gaagaaaagaaggttgaagctcaaatacaaaaatgctccataagtgcaatgacagattta
gttttcctggtagatggttcatggagtgtagggagaaataacttcagatatattctggac
ttcatggttgcccttgtatcagctttcgacattggggaagaaaagacaagagttggagtt
gttcagtacagttcagatacaagaacagagttcaatttaaatcagtatttcagaagaagt
gatcttcttgatgcaattaaaaggataccttataaaggtggcaacacaatgacaggtgaa
gctattgattacctggttaaaaacactttcactgagtcagctggagcaagaaaaggcttt
cccaaagttgcaattgtcattacggatggaaaagctcaagacgaagttgaaattcctgca
agagagcttcgcaacataggagttgaagttttttctttaggaatcaaagcagcagatgca
aaagaactcaagctaattgcatctcagccttcactgaaacatgtgttcaatgtggctaat
tttgatggaattgtagatatacagaatgaaattatattgcaagtgtgctctggagtggat
gaacagctgggtgaactggttagtggggaagaagtggtggagcctgcttcaaatctagta
gccactcagatctcctcaaaatctgttaggatcacttgggatccatccacaagccaaata
actggctatcgggtacagttcatcccaatgatagctggtggaaaacaacatgtgttgagt
gtgggtcctcagactactgctctgaatgttaaagatctctctccagacacagagtatcaa
atcaatgtttatgcaatgaaaggactgacccccagtgagccgataactataatggaaaaa
acacaacaagtcaaagttcaagtggagtgctcacgtggtgtggatgtaaaagctgacgtt
gtgtttttagtggatggctcctacagcattggtatcgccaattttgttaaagtaagagcc
tttttggaagtgttagttaaaagctttgagatatcgcctcgaaaagtacagataagtctt
gtccagtacagcagagatccccatatggagttttctttgaacagatataacagagtggaa
gacataattcaagctattaacaccttcccctacagaggtggatctaccaacacaggcaaa
gcgatgacatatgtgagggagaaagtatttgttaccagcaaaggatcaagaccaaatgtg
ccaagagtcatgattcttatcactgatggaaaatcatcagatgcttttaaagaacctgca
ataaagctgagggatgcagacgtagaaatatttgcagttggtgtgaaggatgcagtgcgt
acagagttagaagcaattgcatcacctcctgctgaaacccatgtttacacagtggaagat
tttgatgctttccaaagaatatcatttgaacttacacagtctgtctgcctacggattgag
caggaactggctgcaataaggaaaaaatcttacgtacctgcaaagaacatggtcttttct
gacgtaacatctgacagtttcaaagtgagctggtctgcagctggatctgaggttttgtcc
tatctcattaaatataaagtagcaatcggcggagatgaattcattgtttcagtcccagct
tcaagtactagctcagttctcaccaacttgctgcctgagactacttatgcagtcagtgtg
attgctgaatatgaagatggcgatggccctcctttggatggagaggaaaccacgttagaa
gttaaaggtgctcctcgaaacttaaggataacagatgaaaccactgacagctttatagtt
ggctggactccagctccaggaaatgttctaaggtacaggcttgtatacagaccacttact
ggaggagaaaggagacaagtgactgtctcagcaaacgaaagatcgactactctgcggaac
ttgattccagatacaagatatgaagtgtctgttattgctgagtatcagtctgggcctggc
aatgcactgaatggatatgcaaaaactgatgaagttcggggaaatccaagaaatctgaga
gtttctgatgctacaacatcaacaatgaagctgtcttggagtgctgctcctggcaaagtg
caacagtactttataacttacacaccagtcgcaggaggtgaaactaaggaattgactgtg
aaaggtgacactacctctaaagtgctgaaaggtttagatgaagccactaggtatgcattg
actgtgtctgccttgtacgcctctggagcaggagaagccctttctggagagggagaaaca
cttgaagaacgtggttcgcctcgcaatttgattaccacagacataactgacacaacagtt
gggttatcatggacaccagctccaggaacagttaataattataggatagtgtggaaatca
ctttatgatgatacaatgggagagaagagagtccctggaaatacggtggatgcagtgctg
gatggcttggagccagagactaaatacaggatttcagtatatgcagcctacagcagtgga
gaaggagatcctgtagaaggagaggcctttactgatgtgtcacaaagtgccaggactgtg
acagtagacaacgagacagagaatacaatgagagtttcatggcagccctcacctgggaag
gtcttgtcttaccgcgtgtactaccgaccacgcagtggaggaaggcagatgtttggaaaa
gtaaatgcttctgccacaagcatagtgttgaagagacttaagcctcgaactacatatgac
ctcagtgttgttccaatttatgattttggacaaggaaaatcaagaaaagcagaaggaaca
acagcctctccctttaagccgcctagaaatttgagaacttctgattcaactatgtccagt
ttccgagtaacctgggagccggcccctgggcgagtgaaggggtacaaagttactttccac
cctactgaagatgacaggaatcttggagaattaattgtgggaccctatgacagcactgtg
gttttggaggaacttagggcaggaactacctataaggtaaatgtttttggaatgtttgat
ggaggagaaagcaaccccctggttggacaagagatgaccactctttcagacactaccacg
gagccatttttatctagaggtttagaatgtagaaccagagcagaagctgatatcgtgcta
ctggtggatggctcatggagtatcgggaggccaaattttaaaactgtcaggaacttcatt
tcccgtattgttgaagtttttgatattggtcctgacaaagtacagattggtcttgcacag
tatagcggagatcccaggacagaatggaatctcaatgcttaccgaacgaaagaggctttg
ttagaggcagtaaccaacttaccatacaaaggaggcaatactctaacaggaatggccttg
gatttcatcttaaaaaacaactttaaacaagaagcaggcttgaggcccagagctcgcaaa
attggtgttctcattactgatggtaaatcacaagacgacgtagtgaccccttcaagaaga
ctcagagatgagggagtagaactttatgcaattggtattaaaaacgcagatgaaaatgaa
ttgaagcaaattgcaacagatccagatgacatccatgcctacaatgttgcagatttctcc
tttctggctagcattgttgaagatgtaaccacaaatttgtgtaatagcgtgaaaggtcca
ggtgatttgccacctccttctaacctagttatttcagaggtaacacctcattctttcaga
ctgagatggagtccacctccagaaagtgttgacagatatcgagttgaatattaccctacc
actggaggtccccctaaacagttttatgtaagtaggatggaaactacaacagttttgaaa
gatctgacacctgaaacagaatacattgttaacgtgttttctgtggtagaagacgaaagc
agtgaacctctaatcggcagggaaataacttatccactgtcttcagttagaaacctgaat
gtttatgacattggatcaacttctatgagagtgagatgggaacctgtcaatggagctact
ggttatttgttaacatatgagcctgtgaatgccacagtcccaaccacagagaaagagatg
cgtgttggaccatcagtgaatgaggttcagctggtagacctcatccccaatactgagtac
actttaacagcttatgtattgtatggtgatatcaccagtgacccgctcacctcgcaggaa
gtgacattacctctgcctgggccaagaggtgtgacaattagggatgttactcacagcacc
atgaatgtcctttgggatcctgccccagggaaagtccgaaaatacatcataagatacaaa
attgctgatgaagctgatgtaaaggaggtggaaattgacagactcaaaaccagcactact
cttactgacctttcttcccaaagactgtataatgtgaaggttgttgctgtgtatgatgaa
ggggaatctctaccagtagctgcagaggctgttactcagcctgtgccatcaccagtcaat
ctgagaatcacagagataaccaagaatagttttagaggaacttgggatcatggagctcca
gatgtttctctctatagaataacctggggaccatatggtagatccgaaaaagcagagagt
attgtaaatggagatgtcaacagtctgctctttgaaaatctgaacccagatacattgtat
gaagtctcggttactgccatttatcctgatgaatcagaaagtgatgacttgattggcagt
gaacgaacattacccttggtacctattacaacaccagctccaaagagtggtccacgaaac
cttcaagtgtacaatgcaacttcacacagtttgactgtaaagtgggatcctgccagtggt
cgagtgcagagatacaagatcatttaccagcctatcaatggagatggcccagaacaatcg
accatggttggtgggcgacagaacagtgtagtaatacagaagctgcagcctgatacacca
tatgctattactgtatcatcgatgtatgcggatggtgaaggaggtcgaatgacaggacga
ggcagaaccaaacctctcactactgtgaagaacatgctagtttatgacccgaccaccagt
actctgaatgtgcgttgggatcatgcagaaggaaatcctcgccagtacaaagtgttttat
agacctacagctggaggtgcagaagaaatgaccacagtaccaggaaacacaaactatgtt
atcctcagatctcttgaacccaacacaccttacactgtaactgtggttccagttttccca
gaaggggatggtggacgtacaactgatactggaagaactttggagagaggaacaccaaga
aacattcaagtttacaatcccacaccaaacagcatgaatgttcgatgggagcctgctcca
ggtccggtacagcaatacagagttaattactctccactatctggcccaagaccatcagaa
tctattgtggtaccagccaacactcgtgatgtgatgctggaacgcttaactcctgacact
gcttactcaataaatgttatagctctgtatgcagatggagaaggaaatccaagccaagcg
cagggaagaacattgcctcgcagtgggccaaggaatctgagagtgttcgatgagacaaca
aacagcctttctgtacaatgggaccatgctgatgggccagtccagcagtacagaatcatc
tattcacccactgtgggagatcctattgatgaatatacaacagttcctggcataagaaat
aatgtcatactacaaccactgcaatcagatacgccgtataaaataactgttgtggctgtg
tatgaagacggagatggtggacagttgactggaaatggaagaactgttggcctgcttcct
cctcagaatatatatataactgatgaatggtatacacgattcagagtttcttgggatcct
tcaccatcccctgttcttggctataaaattgtatacaagcctgtgggttcaaatgagccc
atggaggtttttgtgggggaagtgacatcctacaccttgcataatctgtctcccagtact
acttatgatgtgaatgtttatgcccagtacgactccggaatgagcatacctttgacagat
caaggcactacattatacttgaacgtcaccgacctaacaacttacaaaattggctgggat
actttctgtatccgatggtcacctcaccggtcagcaacttcctacagactaaagctgaac
ccagctgatggatccagaggacaggaaattacagtacgtggatcagaaacaagccattgt
tttactggcctctcaccagacacagaatacaatgcaactgtctttgttcagacccctaac
cttgagggtcctccagtctctgtgagggaacatacggtcctcaaacctacagaggcacca
actccaccgcctacgcctcctccacctcccacaatccctccagctcgggatgtatgcaga
ggtgctaaagcagacatagtgttcttgactgatgcttcctggagtattggtgatgataac
ttcaacaaagtagtaaagtttgtttttaatacagtaggagcctttgacttgattaatcct
gctggaatccaggtttcatttgtgcagtacagcgatgaagcaaaatctgagtttaaactg
aatacatttgatgacaaggctcaagccctgggagctcttcaaaatgttcaatacagagga
ggaaacacacggacaggcaaagccctaacatttatcaaagaaaaggttttgacttgggag
agcggcatgagacgaggtgttcccaaggtacttgttgttgtcacagatggtcgatcacag
gatgaggtgaggaaagcagcaacggtcatacagcactctggcttcagtgtctttgtggtt
ggtgtggctgatgtggattacaatgagctggccaagattgccagtaagcccagtgaacgt
catgtatttattgttgatgactttgatgcatttgaaaagattcaagataacctcgtcacc
tttgtgtgtgagacagctacctcaacttgtcctcttatttacttggaaggatatacttca
cctggtttcaagatgttggaatcatataatctgacagagaagcattttgcttctgtgcaa
ggtgtatcactggaatcaggttctttcccaagctatgtagcatatagactccacaaaaat
gcctttgtcagccagccaatacgggagattcacccagagggactgccacaggcatacact
atcatcatgttattccgtcttctgcctgaatcccccagtgaaccttttgctatttggcag
attacagacagagattacaagccacaagttggagttgtgcttgatcctggcagcaaagtg
ttgtcattctttaacaaggatacaaggggagaagttcaaactgtaacttttgataatgat
gaagtaaagaaaatcttttatggaagcttccacaaggttcatattgttgtcacttcatca
aatgttaagatttacattgactgcagtgaaatactggaaaagccaattaaggaggctggg
aatatcacaactgatggctatgaaatacttgggaaacttctgaaaggtgaccggagatca
gcaacattagaaatccagaattttgacattgtgtgcagtccagtttggactagcagagac
agatgctgtgatcttccttctatgagagatgaagcaaaatgtccagctcttccaaatgct
tgcacctgtactcaagacagtgtgggacctccaggaccccctggacctgctggtggccca
ggtgctaaaggtcctagaggtgaaaggggtttgactggatcatctgggccacctggtcct
cgtggtgagacaggtcctccaggtcctcaaggccctccaggtcctcagggtcccaacggg
ctttcaatcccaggagaaccgggtcggcaaggaatgaaaggtgatgctggccagcctgga
ctaccaggacgatcaggaaccccaggcttacctggtccacctggcccagtgggacctcca
ggtgaaaggggtttcacaggaaaagatggtcccacaggtcccagaggcccaccaggacca
gcgggtgccccaggagttccaggagttgctggtccaagtggaaagccagggaaaccagga
gaccgtgggacaccaggtacacctggaatgaagggagaaaagggtgacagaggtgacatt
gcttctcagaacatgatgcgagcagttgcaagacaagtttgtgaacaattgataaatggc
caaatgagccgattcaatcaaatgttgaatcaaatcccgaacgattattattcaaatcgc
aaccagccagggccaccaggaccacctggtcctccaggagctgctgggacaagaggagag
cctggacctggagggagaccaggattcccaggacctcctggggtccaaggaccacctggt
gaaagaggaatgcctggagagaaaggtgaaagagggactggatctcaaggaccacgaggt
ttgccaggaccacctggtccacagggagaatccagaacaggtccaccaggctccacagga
tcacgaggaccacccgggcctccaggtcgtcctggaaatgcgggtattcgaggtcctcca
gggccaccaggatattgtgattcatcccagtgtgctagcattccttacaatggccaagga
ttcccagaaccatacgttcctgaaagcggaccctatcagcctgaaggtgaacccttcata
gtccctatggagtcagaacggagagaggacgagtatgaggactatggagttgaaatgcat
tcaccagagtaccctgagcacatgcgctggaaaagatcgctgtcaagaaaagcaaaaaga
aagccataa

DBGET integrated database retrieval system