KEGG   Gallus gallus (chicken): 395876
Entry
395876            CDS       T01006                                 

Gene name
F10
Definition
(RefSeq) coagulation factor X precursor
  KO
K01314  coagulation factor X [EC:3.4.21.6]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    395876 (F10)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    395876 (F10)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.6  coagulation factor Xa
     395876 (F10)
Peptidases and inhibitors [BR:gga01002]
 Serine peptidases
  Family S1: chymotrypsin family
   395876 (F10)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   395876 (F10)
SSDB
Motif
Pfam: Trypsin Gla FXa_inhibition EGF DUF1986 Trypsin_2 cEGF hEGF EGF_CA EGF_3 EGF_2
Other DBs
NCBI-GeneID: 395876
NCBI-ProteinID: NP_990353
CGNC: 13760
Ensembl: ENSGALG00000026677
UniProt: P25155
Position
1
AA seq 475 aa
MAGRLLLLLLCAALPDELRAEGGVFIKKESADKFLERTKRANSFLEEMKQGNIERECNEE
RCSKEEAREAFEDNEKTEEFWNIYVDGDQCSSNPCHYGGQCKDGLGSYTCSCLDGYQGKN
CEFVIPKYCKINNGDCEQFCSIKKSVQKDVVCSCTSGYELAEDGKQCVSKVKYPCGKVLM
KRIKRSVILPTNSNTNATSDQDVPSTNGSILEEVFTTTTESPTPPPRNGSSITDPNVDTR
IVGGDECRPGECPWQAVLINEKGEEFCGGTILNEDFILTAAHCINQSKEIKVVVGEVDRE
KEEHSETTHTAEKIFVHSKYIAETYDNDIALIKLKEPIQFSEYVVPACLPQADFANEVLM
NQKSGMVSGFGREFEAGRLSKRLKVLEVPYVDRSTCKQSTNFAITENMFCAGYETEQKDA
CQGDSGGPHVTRYKDTYFVTGIVSWGEGCARKGKYGVYTKLSRFLRWVRTVMRQK
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggccggccgcctgctgctcctgctgctctgcgcggcgttgccggacgagctccgggct
gaaggaggcgtgttcatcaagaaagaaagtgccgacaagttcttggaaagaacaaaacgt
gccaactcttttttagaagaaatgaagcaaggcaatattgaaagagaatgcaacgaggag
cgctgctcaaaagaagaggcaagagaagcctttgaagacaatgagaaaactgaggaattc
tggaatatctacgtagatggcgaccagtgcagctcaaatccatgtcactatggtggacaa
tgtaaagatggacttggttcctacacttgctcctgtttggatggttatcaaggcaagaac
tgtgaatttgtcataccgaagtactgcaaaataaacaatggtgactgtgagcagttctgc
agcatcaaaaaaagcgtgcagaaggatgtcgtgtgttcctgtacaagtgggtatgagctg
gcagaagatggcaaacagtgtgtttcaaaagtaaagtacccatgtggaaaagttctcatg
aaaagaattaaaaggtctgtcatcttacccactaatagtaataccaatgcaactagtgat
caagatgtcccctccacgaatggatcaattctggaggaggtctttactactaccacagaa
agcccaactccccctcctcgcaacggatcgagtatcacagatccaaatgtcgataccagg
atagtaggtggggatgagtgtcgtcctggtgaatgcccatggcaggccgtgctgataaat
gagaagggggaagagttttgtggcggaactatactgaatgaagatttcatccttactgct
gctcattgcataaaccaatccaaagagatcaaagttgttgttggtgaagtggatagagaa
aaggaagaacattctgaaacaacacatactgcagaaaaaatatttgttcactctaagtac
atcgccgagacttatgataatgacatagccctcataaagctgaaggaacccatacagttt
tcggagtatgttgtcccagcatgcctcccacaagcagactttgctaatgaagtgctgatg
aaccaaaagtctgggatggttagtggctttgggcgtgaatttgaagctggacggctttcc
aaaagactgaaagtgctcgaagtcccctatgttgataggagcacttgcaagcagtccact
aactttgcaataacagaaaacatgttctgtgctggttatgaaacagagcaaaaggatgct
tgtcaaggagacagtggaggcccccatgtaaccagatataaggatacttactttgttact
ggaattgttagctggggagaaggatgtgcaaggaagggcaaatacggtgtatataccaag
ctgtccagattcttacgttgggtaaggacagtcatgaggcaaaagtag

DBGET integrated database retrieval system