KEGG   Gallus gallus (chicken): 395877
Entry
395877            CDS       T01006                                 

Gene name
SERPIND1
Definition
(RefSeq) heparin cofactor 2
  KO
K03912  heparin cofactor II
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    395877 (SERPIND1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    395877 (SERPIND1)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    395877 (SERPIND1)
Peptidases and inhibitors [BR:gga01002]
 Peptidase inhibitors
  Family I4: serpin family
   395877 (SERPIND1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   395877 (SERPIND1)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   395877 (SERPIND1)
SSDB
Motif
Pfam: Serpin DUF1139 bCoV_NSP3_N
Other DBs
NCBI-GeneID: 395877
NCBI-ProteinID: XP_001232767
CGNC: 958
Ensembl: ENSGALG00000039239
UniProt: A0A1D5PLZ2
Position
15
AA seq 488 aa
MKFLFPLLALAVIITSTFCGIKDFSDHFESLKDAHTHENGTYNMPDLPLEFHRENTITND
LIPEEEEEEDYLDLDKILGEDDYSDIIDAAPHIVSEIQQGNILELFQGKTRIQRLNILNA
NFGFNLYRSVADKANSSDNILMAPVGISTAMAMISLGLKGQTQQEVLSVLGFEDFINASA
KYELMTVHNLFRKLTHRLFRRNFGYTLRSVNDLYIRKDFSILNDFRNNMKTYYFADAQPA
DFSDPNFITKTNERILKLTKGLIKEALVNVNPTTLMMILNCLYFKGTWENKFPVEMTTKR
SFRLNEKQTIKVPMMQTKGNFLAAADPELDCGVIQLPFVGNISMLIVLPHKLSGMKALEK
QITPQVVEKWQKSMTNRTREVVLPKFKLEKNYNLIGFLRSMGIEELFSEKGNYCGVSEEK
VSIDRFNHQGTITVNEEGTEAGAITNVGFMPLSTQIRFIVDRPFLFLIYEHRTNCLLFMG
RVVNPAKP
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgaagttcctatttcctttgcttgccttggctgtcatcataacctccacattctgtgga
atcaaggacttcagtgaccattttgaaagcctcaaagatgcacatacacacgaaaatgga
acctacaatatgccagacctaccactggagttccacagagaaaacactatcaccaatgac
ttgattcctgaagaggaggaggaagaggactatctagatcttgacaagatattgggtgaa
gacgactacagtgacattatcgatgctgctccacacatagtttctgaaattcagcaagga
aatattctggaacttttccaaggcaaaaccagaatccagcgtcttaatatcctcaatgca
aactttggcttcaatctttatcggagtgtagcggacaaagccaactcctcagacaatatt
ctcatggctcctgttggtatttccactgcaatggctatgatttccctgggtctgaagggt
caaactcagcaggaagtattatctgttcttggctttgaagacttcattaatgccagcgcg
aaatatgagcttatgactgttcataacctctttcggaaactcactcatcggctcttcagg
cgcaattttggttatactctgaggtctgtcaacgatctttatattcgtaaggacttttct
attctgaatgatttcagaaacaatatgaaaacatactacttcgctgatgcccaaccagct
gatttctcagatcctaacttcataaccaaaaccaatgaacgcatcttgaagctgaccaaa
ggattaataaaggaagctcttgtgaatgtaaaccccacaacgcttatgatgattcttaac
tgcctttacttcaaaggaacgtgggagaataagtttccagtggaaatgacaaccaagaga
agttttcgactgaatgaaaagcaaacaataaaggttcctatgatgcagactaaagggaac
ttcctagctgctgcagatccagagctggactgtggcgtgatccagcttccatttgtgggg
aacatcagcatgctgattgtacttccacacaagctctctggcatgaaagccctagaaaag
caaataacccctcaggtggtggaaaaatggcagaagagcatgacgaacagaaccagagaa
gtagttctgcctaaatttaagctggagaaaaactacaacttgattggttttctgagatcc
atgggaatagaagaactattcagtgaaaaaggcaactactgtggtgtatcggaagagaaa
gtctccattgacagattcaatcatcaaggcacaataactgtgaatgaggaaggcacagaa
gctggagcaataaccaacgttggattcatgcctctttctactcagattcgctttattgtc
gaccgcccctttttgtttctgatctatgaacatcgtaccaattgccttctgttcatgggt
agagttgtcaaccctgccaagccttaa

DBGET integrated database retrieval system