KEGG   Gallus gallus (chicken): 395886Help
Entry
395886            CDS       T01006                                 

Gene name
MITF
Definition
(RefSeq) microphthalmia-associated transcription factor
  KO
K09455  microphthalmia-associated transcription factor
Organism
gga  Gallus gallus (chicken)
Pathway
gga04137  Mitophagy - animal
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    395886 (MITF)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    395886 (MITF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395886 (MITF)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    395886 (MITF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MITF_TFEB_C_3_N DUF3371 HLH Ribophorin_I
Motif
Other DBs
NCBI-GeneID: 395886
NCBI-ProteinID: NP_990360
CGNC: 49531
Ensembl: ENSGALG00000039583
UniProt: O73871
Position
12
AA seq 468 aa AA seqDB search
MTSRILLRQQLMREQMQEQERREQQQKQQAAQFMQQRVPVSQTPAINVSVPASLPPATQV
PMEVLKVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQALSLPCPNQPGDHVMPPG
TGSSAPNSPMAMLTLNSNCEKEGFYKFEEQSRVESECPALNTHSRASCMQMDDVIDDIIS
LESSYNEEILGLMDPALQMANTLPVSGNLIDLYGNQSMPPPGLNISNSCPANLPNIKREL
TESEARALAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASV
DYIRKLQREQQRTKELENRQKKLEHANRHLLLRIQELEMQARAHGLSLVPSTGICSPDMV
NRVIKQEPVLDNCNQDLMPHHTDLSCTTTLDLTDGTITFSDNLGNVTEPTGTYSVPAKMG
SKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSVSMEDTDHAC
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacctcacgaatcctgctacggcagcagctcatgcgtgagcagatgcaggagcaggag
cgtcgggagcagcagcagaagcagcaagcagcccagttcatgcaacagagagttcccgtc
agccagacacctgccatcaacgtcagcgtgcccgccagcctgccccctgccacgcaggta
cccatggaggtcctcaaggtgcagactcaccttgagaatccaaccaaataccatattcag
caagctcagcggcagcaggtaaagcagtacctctctaccactctagcaaataaacacgcc
aaccaagccctgagcttgccatgtccaaaccagcccggtgatcatgtcatgccgcctgga
actggaagcagtgcgcccaacagtccgatggctatgctcaccctcaactccaactgtgaa
aaagagggattttataaatttgaagagcaaagcagggtcgagagtgagtgcccggctctg
aatacccactcacgagcatcatgcatgcagatggatgatgtgattgatgacataattagt
ctggaatcaagttacaatgaagaaatccttggcttgatggacccagccttgcaaatggca
aatacgttaccagtgtctgggaatttgattgacctttatggcaaccaaagcatgcctcct
ccaggacttaacatcagcaactcctgtccagctaatcttcctaatataaaaagggagctc
acagagtcagaagcgagagcactggctaaggagaggcaaaagaaagacaatcacaacttg
attgaacgaagaagaagatttaatattaatgaccgtataaaagaactgggcaccttgata
cccaaatcaaacgacccggatatgcgctggaataagggaactattctaaaagcatcagtg
gactacatccgtaagctgcaaagagagcagcaacgcacgaaggaacttgagaacagacag
aagaaattggaacacgccaacaggcacctgctgctcagaatacaggaacttgagatgcaa
gctcgggcacatggactgtcccttgttccatccacaggcatttgctcccctgatatggtc
aacagggtcatcaaacaagaacctgtgctggacaactgcaaccaagacctcatgccgcac
cacacagacctgtcttgcactaccacccttgatctcactgatggtaccatcaccttcagt
gacaacctcggaaatgtgactgaaccaactggcacttacagtgttcctgcaaaaatggga
tccaaactggaagacatcttgatggacgataccctctcccccgtaggagtaactgaccca
ctgctttcctctgtgtctcctggagcatcgaaaacgagtagcaggcggagcagcgtgagc
atggaggacactgatcatgcttgttag

DBGET integrated database retrieval system