KEGG   Gallus gallus (chicken): 395887
Entry
395887            CDS       T01006                                 
Symbol
AMH
Name
(RefSeq) muellerian-inhibiting factor precursor
  KO
K04665  anti-mullerian hormone
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
gga04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    395887 (AMH)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    395887 (AMH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    395887 (AMH)
Cytokines and growth factors [BR:gga04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   395887 (AMH)
SSDB
Motif
Pfam: AMH_N TGF_beta
Other DBs
NCBI-GeneID: 395887
NCBI-ProteinID: NP_990361
CGNC: 537
Ensembl: ENSGALG00000036346
UniProt: Q788U7
Position
28:complement(2107518..2111709)
AA seq 644 aa
MKAALGVLLPYLVLLLRSTALPRKGTPGAEAVLEQSLSEEMGLGAKRENVSRARPGLAVR
PKMTAASRLLPEPAASCTQADGSSLQPWPLGGLEGPVCRLKMDRNEVPPSHLEVVGVLTR
YESAFIKVLRAGWEHRSPETFGLCPGGDAQTVLRPLQQLQEHLAGPGMGLQRFLILHLEE
VKWEAQPRLWFRLPFHAEVGRLLGELHVALLLFYPGSPTGRRAEGRQELLVEGTGLTQEQ
SLCFTRDTQYLLLRASVAAVSSSSKELSFQLSLTIRHHGDGGAPLSLMETQQLLFGSDEK
CFTRMTPVLLLLAGSPPEGDAAAPSSYLSASGVVDVAPYPQLSPPHPGTAELPPHTTASP
ANTTSPTPGDSGQFLGVLTLFIRRVLSPRSEPPTQPSSQHWLDFQMMETLPHQLLNLSET
AALERLVQSEEPSVLLFPQEGGAGLEQHFGDWQPEGTVLQLLMGKLQAVIHELRDIPEFQ
ANTGLFQHLLSFCYHPPGPAAGGQPPGSGKLHALLLLKALQTVRARWQERRKVLRQNRSA
RHQAHCRLQELTIDLRDRNFIVMPTVYEANNCEGPCRLPLSTRVPGYHSHTVLLLGMQER
GSPLQPLPCCVPVRYSDQLIISVLAEGLEVRKFPNMVAEECGCR
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgaaggcggctctcggggtgctgctgccatacctggtgctgctgctccgctccacagct
ttgccgagaaaagggacccccggagcagaggctgtgctggagcagagcctctcggaggag
atgggacttggagcaaagagggaaaatgtgagcagagcgcgacccggcttggcggtgaga
ccgaagatgaccgcggcttctcgcctcctcccagagcctgcagcaagctgcacccaggct
gacggctccagcttgcagccctggcccctgggagggctggagggccccgtgtgccgcctg
aagatggaccgcaacgaggtccccccatcccacctggaggtggtgggggtcctcacccgc
tatgaaagtgccttcatcaaagtgctgcgcgccgggtgggagcaccgcagccccgagacg
tttgggctgtgcccgggtggggatgcacaaaccgtgctccgaccgctgcagcagctccag
gagcacctggcggggccgggcatggggctgcagcgcttccttatcctgcacctggaggaa
gtgaagtgggaagcacagccccggctctggttcaggctgccgttccatgcggaggtgggg
cggctgctgggagagctgcacgtcgctctgctgctcttctacccgggcagccccacgggg
agacgggctgagggccgccaggagctgctggtggagggcacggggctgacacaggagcag
agcctttgcttcactagggacacccagtacctactcctcagagcctcggtggccgccgtg
agcagcagcagcaaggagctgagcttccagctgtccctgaccatcaggcaccatggggat
ggaggtgcccctctgtccctcatggagacccagcagctcctctttggctcagatgagaag
tgtttcaccaggatgacgccggtgctgctcctgctggccgggtcaccacctgagggtgat
gctgccgccccttcctcctatctctctgccagtggggtggtggatgtggctccctaccca
cagctcagcccaccccatcccggcaccgcagagctgccgccccacaccactgccagccca
gccaacaccacatccccaacgcctggggacagcgggcagttcctgggtgtgctgaccctc
ttcatccgccgggtgctgagcccccgcagcgagccgcccacccagcccagctcccagcac
tggttggacttccagatgatggagacgctccctcaccaactactcaacctgtcggagacg
gccgccctggagcgcctggtgcagtcggaggagccctcggtgctgcttttcccccaggag
ggcggcgcagggctggagcagcattttggggactggcagccagaggggacggtgctgcag
ctgctgatgggcaaactgcaggcggtgatccacgagctgagggacatcccggagttccaa
gccaacacggggctcttccagcacctcctcagcttctgctaccaccctccagggccggct
gcgggcgggcagcccccaggctcagggaagctgcacgcactgctgctgctgaaggcgctg
caaacggtgcgggcgcgctggcaggagaggaggaaagtcctgcggcagaaccgcagcgcg
cggcaccaggcgcactgcaggctgcaggagctgaccatcgacctgcgcgaccgcaacttc
atcgtcatgcccaccgtctacgaggccaacaactgcgaggggccctgcaggctgcccctc
tccacccgcgtgcccggctaccactcgcacaccgtgctgctgctgggcatgcaggagcgg
ggttcgccgctgcagccgcttccatgctgcgtgcccgtccgttactcggaccaactcatc
atcagcgtgttggccgaggggctggaggtgcgcaagttccccaacatggtggcggaggag
tgcggctgtcggtag

DBGET integrated database retrieval system