KEGG   Gallus gallus (chicken): 395895Help
Entry
395895            CDS       T01006                                 

Gene name
CACNA1D
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1D
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04020  Calcium signaling pathway
gga04218  Cellular senescence
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04530  Tight junction
gga04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    395895 (CACNA1D)
   04020 Calcium signaling pathway
    395895 (CACNA1D)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    395895 (CACNA1D)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    395895 (CACNA1D)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    395895 (CACNA1D)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    395895 (CACNA1D)
   04261 Adrenergic signaling in cardiomyocytes
    395895 (CACNA1D)
   04270 Vascular smooth muscle contraction
    395895 (CACNA1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    395895 (CACNA1D)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   395895 (CACNA1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel DUF4834 Rer1
Motif
Other DBs
NCBI-GeneID: 395895
NCBI-ProteinID: NP_990365
CGNC: 49537
Ensembl: ENSGALG00000005332
UniProt: O73700
Position
12
AA seq 2190 aa AA seqDB search
MQHHQQQQPEQHPEEANYASSTRIPLPGDGPTTQSNSSAPSKQTVLSWQAAIDAARQAKA
AQNMNTTTAQPVGSLSQRKRQQYAKSKKQGNTSNSRPPRALFCLSLNNPIRRACISLVEW
KPFDIFILLSIFANCVALAVYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKIIAYGL
LLHPNAYVRNGWNLLDFVIVVVGLFSVILEQLTKETEGGSHSGGKPGGFDVKALRAFRVL
RPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKSCFLID
SDILVEEDPAPCAFSGNGRQCVMNGTECKGGWVGPNGGITNFDNFAFAMLTVFQCITMEG
WTDVLYWVNDAIGCEWPWIYFVSLIILGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKL
REKQQLEEDLKGYLDWITQAEDIDPENDEEADEEGKRNRVTLADLMEEKKKSRLSCFGRS
SNKHASMPTSETESVNTENVSGEGENPACCGSLCQTISKSKFSRRWRRWNRFNRRKCRAA
VKSVTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGL
QAYFVSLFNRFDCFVVCGGIVETILVELEIMSPLGISVFRCVRLLRIFKVTRHWASLSNL
VASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVF
QILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAE
SLNTAQKEEAEEKERKKNARKESLENKKSEKSEGDQKKPKDSKVTIAEYGEGEDEDKDPY
PPCDVPVGEDEEDEEDEPEVPAGPRPRRISELNMKEKITPIPEGSAFFIFSSTNPIRVGC
HRLINHHIFTNLILVFIMLSSVSLAAEDPIRSHSFRNNILGYADYVFTSMFTFEIILKMT
AFGAFLHKGSFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAK
GLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYKCTDEAKQNPEECRGIY
IVYKDGDVDNPMVKERVWQNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVG
PVYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYA
LKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAMQHYGQSKLFNDAMDI
MNMVFTGVFTVEMVLKLIAFKPKIFVRKKERWLGYFSDAWNTFDSLIVIGSIVDVVLSEA
DPKPTETVTTDESGNSEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALP
YVALLIAMLFFIYAVIGMQVFGKVAMRDNNQINRNNNFQTFPQAVLLLFRCATGEAWQEI
MLACLPGKRCDPESDYNPGEEYTCGSNFAIIYFISFYMLCAFLIINLFVAVIMDNFDYLT
RDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRL
VAMNMPLNSDGTVMFNATLFALVRTALKIKTEGNLEQANEELRAVIKKIWKKTSMKLLDQ
VVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNTTIALQAGLRTLHDIG
PEIRRAISCDLQDDEPEENNPDEEEEVYKRNGALFGNHINHISSDRRDSFQQINTTHRPL
HVQRPSIPSASDTEKNIYPHTGNSVYHNHHNHNSVGKQVPNSTNANLNNANVSKVVHGKH
ANFGSHEHRSENGYHSYSRADHEKRRRPSSRRTRYYETYIRSDSGDGRRPTICREERDIR
DYCNDDHYLGEQEYYSGEEYYEEDSMLSGNRHVYDYHCRHHCHDSDFERPKGYHHPHGFF
EEDDSQTCYDTKRSPRRRLLPPTPASNRRSSFNFECLRRQSSQDDIPLSPNFHHRTALPL
HLMQQQVMAVAGLDSSKAHKHSPSRSTRSWATPPATPPNRDHTPYYTPLIQVDRAESTEH
MNGSLPSLHRSSWYTDDPDISYRTFTPANLTVPNDFRHKHSDKQRSADSLVEAVLISEGL
GRYAKDPKFVSATKHEIADACDMTIDEMESAASNLLNGNISNGTNGDMFPILSRQDYELQ
DFGPGYSDEEPEPGRYEEDLADEMICITSL
NT seq 6573 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaccaccagcagcagcagcccgagcagcacccagaagaggcgaactatgcaagc
agcaccagaattcctctccctggtgacggaccaactactcagtccaacagttcagcacca
tccaagcaaactgttctgtcttggcaagctgcaattgatgctgctagacaagcaaaggct
gcccaaaatatgaataccaccacagcccagcctgtaggatctctgtcccaaagaaaacgc
cagcaatatgccaagagcaaaaaacagggtaatacgtctaatagtcggccaccccgtgcc
cttttctgtttatccctcaacaacccaatacgaagagcctgcattagtctagtagaatgg
aaaccatttgacatatttatactactgtctatttttgccaattgtgtggccttagctgtt
tacatcccattcccagaagatgattctaattcaactaatcataacttggaaaaagtagaa
tatgccttcctgataatttttacagttgaaacatttttgaagattatagcatatggatta
ttattacaccccaatgcgtatgttagaaatggatggaatttattggattttgtaatagta
gtagtaggattatttagtgtaatattggaacaattaaccaaagaaacagaaggtggcagc
cactcaggtggcaaacctggaggctttgatgtcaaagccctaagagcctttcgtgtattg
cgacctctccggcttgtatcaggagtgcccagtttacaagttgtcctgaactccattata
aaagccatggttcccctgctccatattgcccttttggtattgtttgtaatcataatctat
gctattataggattggaactttttattggaaaaatgcacaaatcttgttttcttattgat
tcagatatactagttgaagaagatccagcaccttgtgcattctcagggaatggacgtcag
tgtgtcatgaatggcactgaatgtaagggtggttgggttggaccgaatggaggcataacg
aacttcgataattttgcatttgcaatgctgactgtattccagtgtataaccatggaagga
tggactgatgtgttatactgggtaaatgatgcaataggatgtgaatggccatggatctat
tttgttagtcttatcatccttggctcatttttcgtacttaacctggttcttggtgtactt
agtggggaattttccaaggaaagagaaaaagccaaggcccgaggggactttcagaagcta
cgtgaaaaacaacagcttgaagaagatctgaagggatatttagactggattacacaggca
gaagacattgatcctgagaatgatgaagaggctgatgaagaagggaaacggaacagggtt
acactggctgacttaatggaagaaaagaagaaaagcagacttagttgctttggccggtct
tccaataaacatgcaagcatgcccaccagcgaaaccgagtcagtgaacacagagaatgtg
agtggagaaggagagaacccagcatgctgtgggagcttatgtcaaaccatctcaaaatcc
aagttcagtcgacgctggcgtcgctggaatcgatttaatcgaagaaaatgtagagctgca
gtaaaatctgtcacgttttattggcttgttattgtcttggtctttctgaacacattaact
atctcatcggaacattataaccaacctgactggctgacccagatccaagatatcgcaaat
aaagttcttctggctttgttcacctgtgaaatgttagtaaagatgtacagcttgggtcta
caggcttattttgtttctctttttaaccgctttgattgcttcgttgtttgtggtggcatt
gttgaaaccattttggtggagttggaaattatgtcaccccttggaatttcagtgtttcgc
tgtgttcgtctcctgcgtatttttaaagtaacaaggcactgggcatccctgagcaacttg
gtagcatccttgttaaactcaatgaagtccattgcttcactgttgcttctgcttttcctc
ttcatcataatcttctcgttgcttggaatgcagctgtttggaggcaaatttaattttgat
gaaactcaaacaaaacggagcaccttcgataattttccacaagctcttttaactgtattc
cagattctaacaggtgaagactggaatgctgttatgtatgatggcataatggcgtatggt
ggcccatcatcgtcaggcatgatagtctgcatatatttcattatcctcttcatctgcggt
aactatatcttgctaaatgtcttcttggccattgctgtggataacttggcagatgctgaa
agtctaaatacagctcagaaagaagaagcagaagaaaaggaaaggaaaaagaatgcaaga
aaagaaagtctggaaaataaaaaaagtgagaagtcagaaggtgaccaaaagaagcccaag
gatagtaaggtgacaattgctgaatatggagaaggagaggatgaagataaagatccctat
ccaccctgtgatgtaccagtaggtgaagatgaagaagatgaggaggatgaacctgaggta
ccagcaggcccacgtccccggagaatatcagaactaaacatgaaggagaagataacaccg
atccctgaagggagtgccttcttcattttcagcagcaccaatccaattcgagtgggatgc
cacaggctcatcaatcaccacatctttaccaatctcatccttgtcttcatcatgctgagc
agtgtttccctagcagcagaagatccgattcgcagccactcttttcgaaataatatccta
gggtatgcagattatgtcttcactagtatgtttacatttgagatcattttgaagatgaca
gctttcggagcattccttcataaagggtccttctgcagaaattactttaatttgctggat
ttgctggttgtgggtgtttctctggtatcatttggtattcagtcaagtgctatctcagtt
gtgaagatcctcagagttttgagagtcttgaggccccttagggctataaacagagcaaaa
ggacttaagcacgttgttcagtgcgtctttgtggctattagaactattggtaatatcatg
attgttacaactctgctgcagttcatgtttgcttgtattggagtgcagctcttcaaggga
aaattctacaagtgcactgatgaggcaaaacagaatccagaggaatgccgggggatatac
attgtttataaagatggagatgttgataatccaatggtcaaagagagggtctggcaaaat
agtgatttcaacttcgacaatgttctgtctgctatgatggcccttttcacagtgtctact
tttgaaggctggccagcgctgctgtacaaagccattgattccaatggcgagaatgtagga
cctgtgtacaactacagagtggagatctccatttttttcatcatctacatcatcattatt
gctttctttatgatgaacatatttgttggttttgtcattgttacctttcaagaacaggga
gaacaagaatacaagaactgtgagctggacaaaaatcagcgtcagtgcgtggaatatgcc
ttgaaggctcgtcctcttcgtagatacattccaaaaaatccttaccagtataagttctgg
tatgtggtgaattctactggatttgaatacatcatgtttgtcctcatcatgctgaacaca
ctttgcctggctatgcagcactatggacagtctaagctctttaatgatgcgatggacatt
atgaatatggttttcacgggagtgttcactgttgaaatggttttgaagctgattgcattc
aaacccaagatttttgtaagaaaaaaggaaagatggctaggctattttagtgatgcctgg
aatacgtttgactccctcatcgttattggcagcatagtagacgtcgttctcagtgaagct
gatccaaagccaactgaaacagtcacaactgatgagtctgggaactccgaagacagcgca
agaatctccatcacttttttccgtcttttccgagtgatgaggttggtgaagctgcttagc
agaggagaaggaatcagaactttattgtggacatttattaagtcatttcaggctctgcct
tatgttgcccttctgatagctatgctgttcttcatctatgctgtcattggaatgcaggta
tttggaaaagtggccatgagagacaacaatcaaataaacagaaacaacaattttcaaact
ttcccccaagctgtgctgcttctcttcaggtgtgcaactggagaagcctggcaggaaatc
atgctggcatgtttgcctggaaaacgctgtgatccagaatctgattataatccaggggaa
gaatacacatgtggaagcaattttgccatcatttattttatcagtttttatatgctttgt
gcatttttgataataaacttatttgtggctgtcattatggataactttgactatttgaca
cgtgactggtccattctgggtcctcatcatttggatgagttcaaaaggatatggtcagaa
tatgaccctgaagcaaagggaaggataaagcatcttgatgtggttacgttactgagacgc
attcagccaccacttggttttggcaaattatgccctcaccgggtggcctgcaagaggtta
gtggccatgaatatgccactaaatagtgacggaaccgtcatgttcaatgctactttgttt
gctttggttaggactgctctaaagataaaaacagaaggtaacctagagcaagcaaatgaa
gaacttagagcagttataaagaaaatatggaagaaaactagcatgaaattacttgaccaa
gttgtccctccggctggcgatgatgaggtaaccgtggggaagttctatgccaccttcctg
atacaggactactttaggaaattcaagaaacgcaaagaacaaggactggtggggaaatat
cctgcgaagaataccacgattgctctgcaggcaggactaaggacacttcatgatattggc
cctgaaatacgccgagctatatcctgtgacttgcaagatgatgaaccagaggaaaacaat
ccagacgaggaggaggaagtttataaaaggaatggtgccctctttggcaaccatataaac
catattagcagtgacagacgagattcatttcagcagatcaacaccacgcaccgtccctta
catgtgcagcggccttcaattccatctgcaagtgatactgagaaaaatatatatcctcat
acaggaaattctgtgtaccacaatcatcataaccacaactcagtaggaaaacaagttcca
aactcaacaaatgccaatctcaataatgccaacgtatccaaagttgttcacggaaaacac
gctaattttggaagtcacgagcatagatctgaaaatggttaccattcgtactctagagct
gaccatgagaagcgtagaaggccaagcagtaggagaacccgctactacgaaacatatatt
aggtctgactctggtgatggccgtcgaccaactatttgccgtgaagaacgtgacattcga
gactattgcaatgatgatcattatttgggagagcaggaatattatagtggagaagaatac
tatgaggaagacagcatgttgtcaggaaacagacatgtgtatgattaccactgtagacat
cactgccatgactcagattttgagagaccaaaaggttaccatcacccacatgggtttttt
gaggaagatgattcacagacctgttatgatacgaaaagatctcctaggagacggctgcta
cctccaacaccagcatcaaatagacgatcttcctttaattttgaatgcctccgccgacag
agtagtcaagatgatataccactctctccaaatttccatcatcgcactgctttaccactt
cacctaatgcaacagcaggtcatggctgttgcaggtctggattccagtaaagctcataaa
cattcaccaagtcgttccacgcgttcatgggctaccccacctgcaacccctcccaacagg
gaccataccccatactatacacctctaatccaagttgacagggctgaatctacagaacat
atgaatggtagcctgccttccttgcacaggagctcctggtacacagacgaccctgatatc
tcctaccgaacatttacaccagccaatttaacagtacctaatgactttaggcataaacac
agtgacaaacagaggagtgcagacagtttggtagaagcggtacttatatctgaaggccta
ggaaggtatgcaaaggaccctaaatttgtttcagctacaaaacatgagattgctgatgct
tgtgacatgactatcgatgagatggaaagtgcagcaagtaatcttctcaatggaaatatt
agcaatgggaccaatggggatatgtttcccattttaagcagacaagattatgaacttcaa
gattttggtcctggctacagtgatgaagaaccagaaccaggacgatatgaagaagactta
gctgatgaaatgatatgcattacaagcttatag

DBGET integrated database retrieval system