KEGG   Gallus gallus (chicken): 395896Help
Entry
395896            CDS       T01006                                 

Gene name
EFNB1
Definition
(RefSeq) ephrin-B1 precursor
  KO
K05463  ephrin-B
Organism
gga  Gallus gallus (chicken)
Brite
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   395896 (EFNB1)
Cytokines and growth factors [BR:gga04052]
 Growth factors
  Growth factors (RTK binding)
   395896 (EFNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin DUF4381 Shisa Baculo_11_kDa Orthoreo_P10 TMEM132D_C Glucos_trans_II WBP-1 EphA2_TM Cytomega_TRL10 PalH Stevor ECSCR Syndecan TMEM154 SKG6
Motif
Other DBs
NCBI-GeneID: 395896
NCBI-ProteinID: NP_990366
CGNC: 49538
Ensembl: ENSGALG00000036539
UniProt: O73612
Position
4
AA seq 334 aa AA seqDB search
MARPRGGRWLLGVLLALCRLAAPLAKSLEPVSWSAGNPKFMSGKGLVIYPEIGDKLDIIC
PKAEPSKPYDYYKLYLVKKDQADACSTVMDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGL
EFKRQQDYFITSTSNGTLDGLENREGGVCQTRSMKIVMKVGQDPNAVIPEQLTTSRPSKE
ADNTVKIVTQSPRHKVPTVEEPGKPGSVNQNGQETQGPSDGFLSSKVAVFAAIGAGCVIF
ILIIIFLVVLLIKIRKRHRKHTQQRAAALSLSTLASPKCSGNAGSEPSDIIIPLRTTENN
YCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggccccgcggcgggcggtggctgctgggggtgctgctcgccctgtgccgcctg
gccgcgccgctcgccaagagcctggagcccgtctcttggagcgccggcaaccccaaattc
atgagtgggaaagggttggtcatctacccggagattggggacaaactggacattatctgc
cccaaggcggagccgtccaagccttacgattactacaagctgtacctggtgaaaaaggac
caggcagatgcctgcagcaccgtcatggaccccaacgtgctggtgacgtgcaaccggccc
gagcaggagatccgcttcaccatcaagtttcaggagttcagccccaactacatgggcctg
gagttcaagcggcagcaggattacttcatcacatccacctctaatgggacactggatggc
ctggagaaccgggaaggaggggtctgccagacacgctccatgaagatcgtcatgaaagtg
gggcaggatccaaacgcggtgatcccggagcagctgacgacgagtcggcccagcaaggag
gcagacaacaccgtgaagattgtgacgcagagcccacgccacaaagtccccacggtggag
gagcccggcaagccaggttccgtcaaccagaacggccaggagacccaaggtcccagcgat
gggttcctgagctccaaagtcgccgttttcgctgccatcggcgcgggctgcgtcatcttc
atcctcatcatcatcttcctcgtcgtcctcctgatcaagatccgcaagcggcaccggaag
cacacgcagcagcgggccgcagccttgtccctcagcaccttggccagccccaaatgcagc
gggaacgccggctcagagcccagcgacatcatcatccccttacggactacagagaacaac
tactgcccgcactacgagaaggtgagcggggactacgggcaccccgtctacatcgtgcag
gagatgcccccacagagcccagccaacatttactacaaggtgtga

DBGET integrated database retrieval system